KEGG   Pseudomonas sp. MRSN12121: TO66_29015Help
Entry
TO66_29015        CDS       T03702                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00260  Glycine, serine and threonine metabolism
psem01100  Metabolic pathways
psem01110  Biosynthesis of secondary metabolites
psem01120  Microbial metabolism in diverse environments
psem01130  Biosynthesis of antibiotics
psem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TO66_29015
Enzymes [BR:psem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TO66_29015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AJO81111
UniProt: A0A0C5ECQ5
Position
6357115..6358155
Genome map
AA seq 346 aa AA seqDB search
MTDKSQQFASDNYSGICPEAWAAMEQANHGHERAYGDDQWTARAADYFRKLFETDCEVFF
AFNGTAANSLALSSLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLVAGTENGKLTPD
SIREIALKRQDIHYPKPRVVTLTQATEVGSVYTPEEIRAISATCKELGLNLHMDGARFSN
ACAFLGCSPADLTWKAGVDVLCFGGTKNGMAVGEAILFFNHKLAEDFDYRCKQAGQLASK
MRFLSAPWVGLLEHDAWLKYARHANHCAQLLAQLVADIPGVELMFPVQANGVFLQLSEPA
IAALTARGWRFYTFIGKGGARFMCSWDTEEARVRELAADIRQVMAG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagagccaacaattcgccagcgacaactattccggtatctgccccgaggcc
tgggcggccatggaacaagccaaccacggccatgaacgcgcctatggcgacgaccagtgg
accgcccgcgccgccgattatttccgcaagctgttcgagaccgactgcgaagtgttcttc
gccttcaacggcaccgccgccaactccctggccctgtcgtcgctgtgccagagttaccac
agcgtcatctgctcggaaaccgcccacgtcgaaaccgacgaatgcggcgccccggaattc
ttctccaacggttccaagctgctggtggccggcaccgagaacggcaagctgaccccggac
tcgatccgcgagatcgccctcaagcgccaggacatccactatcccaagccccgggtggtg
accctgacccaggccaccgaagtcggcagcgtctacaccccggaagaaatccgcgccatc
agcgccacctgcaaggagctggggctgaacctgcacatggacggcgcgcgcttctccaat
gcctgcgccttcctcggctgctcgccggccgacctgacctggaaagccggggtcgacgtg
ctgtgcttcggcggcacgaaaaacggcatggcggtcggcgaggcgatcctgttcttcaac
cacaagctggccgaagacttcgactaccgctgcaagcaggccgggcaactggcctcgaag
atgcgtttcctgtccgcgccctgggtcggcctgctggaacacgacgcctggctcaagtac
gcccgccacgccaaccactgcgcgcaattgctggcccagctggtggcggacatccccggg
gtggagctgatgttcccggtgcaggccaacggtgtgttcctgcaactctcggaaccggcc
atcgccgcgctgaccgccaggggctggcgtttctacaccttcatcggcaagggcggggcg
cgcttcatgtgctcctgggacaccgaagaagcgcgggtgcgtgaactcgccgcggatatc
cgccaggtcatggccggctga

DBGET integrated database retrieval system