KEGG   Pseudoalteromonas sp. NC201: PNC201_01075Help
Entry
PNC201_01075      CDS       T05464                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
psen  Pseudoalteromonas sp. NC201
Pathway
psen03010  Ribosome
Brite
KEGG Orthology (KO) [BR:psen00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PNC201_01075 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:psen03011]
    PNC201_01075 (rplV)
Ribosome [BR:psen03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PNC201_01075 (rplV)
  Bacteria
    PNC201_01075 (rplV)
  Archaea
    PNC201_01075 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: AUJ68560
UniProt: A0A2K9JYA3
Position
259373..259705
Genome map
AA seq 110 aa AA seqDB search
MEALAKHKFASGSAQKARLVADQIRGLPVDRALEILAYSPKKAAVLVKKVLESAIANAEH
NEGADIDELKVAKVFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSDS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattagctaaacacaaattcgcctctggttcggcgcagaaagcacgtctagtg
gcagatcagatccgtggacttccggttgatcgcgcgctagaaatcctggcgtacagcccg
aagaaagcggctgtattagttaagaaagtacttgagtctgctatcgcgaacgcggagcac
aacgaaggtgctgacattgatgagcttaaagtggctaaagtatttgtagacgaaggtcct
acaatgaaacgtattatgccacgtgctaaaggacgcgcagaccgcatccttaagcgtaca
agccacatcactgttgtggtatcggatagctag

DBGET integrated database retrieval system