KEGG   Pseudoalteromonas sp. NC201: PNC201_08725Help
Entry
PNC201_08725      CDS       T05464                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
psen  Pseudoalteromonas sp. NC201
Pathway
psen00780  Biotin metabolism
psen01100  Metabolic pathways
Module
psen_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:psen00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PNC201_08725 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psen01007]
    PNC201_08725 (bioF)
Enzymes [BR:psen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     PNC201_08725 (bioF)
Amino acid related enzymes [BR:psen01007]
 Aminotransferase (transaminase)
  Class II
   PNC201_08725 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AUJ70039
UniProt: A0A2K9JX69
Position
complement(2077797..2078939)
Genome map
AA seq 380 aa AA seqDB search
MSFEYIQSALAARHAEGLLRKRIVVEKASASRIKIADQQYINFASNDYLGLADSLEFNTL
ACTEAGSRSSALVTGYLDIHRQLEDKLCSVLGYDAALLFPSGFAANTSVLKALFTPQEKQ
LSAAVFQDKLNHASLLDGGLAGSAKFVRFNHNDLTHLRSRLEKTKADSKLIVTEGVFSMD
GDKAPISEISVLAKSHSAWLMVDDAHAFGVVGAQGLGTIESGIKPEILVITFGKAMGCQG
AAVLASHDVINYMTQFNREFIYTTALSPIMASVALCQLNKLLAASEARHKLQVNIDYFKS
LVAQTNLSPIPSDTAIQPLVYGSSENVLAAQHKLKEKGLWVGAIRPPTVPQNTARLRITI
TAQHSHEDIDNLVSALVEGA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgagtatattcaatctgccttagcagctcgtcacgctgaagggttgctaaga
aaacgcattgtggttgaaaaggcctctgcaagtagaattaaaattgctgatcagcaatat
attaactttgccagcaatgactacctgggacttgcagactcgttggaatttaacactctc
gcatgcactgaagccggaagccgtagttcggcgcttgttacgggttatcttgatattcac
cgtcagctagaggataagctttgcagcgttttgggttatgatgccgcactgttatttcca
agcggttttgccgctaataccagtgtgttaaaggcattgttcacgccccaagaaaagcaa
ttaagcgctgcggtgttccaagataagctcaaccacgccagcctgttagacggtggttta
gcgggtagcgctaagtttgttcgctttaatcacaatgatttgacgcacttaaggtctcga
ttagaaaaaaccaaagccgacagtaaactcattgtgactgaaggggtgttttctatggat
ggagacaaagcgccgatatctgaaatcagtgtgctggctaagtctcattctgcgtggctc
atggtcgacgacgctcatgcgtttggcgttgtgggagcgcaaggacttggcacgattgaa
agcggcattaaacctgaaattttggtgatcacctttggcaaagcgatgggctgtcaagga
gctgcggtattagcaagtcatgatgtgataaattacatgacgcaatttaatcgtgagttt
atctatacaacggcgttgtcgcctattatggcaagcgttgcattatgccagttgaataaa
ttgcttgctgcatctgaagcgagacacaaattacaagtaaacatcgactattttaagtcg
ttagttgcacaaaccaacttatctcctattccaagtgatacggccatacagcctcttgtg
tatggtagcagcgaaaatgtattagcggcgcaacataaacttaaggaaaagggactttgg
gttggggctataaggccaccaacggttccgcaaaataccgcacgattgcgaataacaata
acggcacagcacagtcacgaagatatagacaatttagtttcggccttagtggagggagca
tga

DBGET integrated database retrieval system