KEGG   Pseudoalteromonas sp. NC201: PNC201_13320Help
Entry
PNC201_13320      CDS       T05464                                 

Gene name
ispA
Definition
(GenBank) Farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
psen  Pseudoalteromonas sp. NC201
Pathway
psen00900  Terpenoid backbone biosynthesis
psen01100  Metabolic pathways
psen01110  Biosynthesis of secondary metabolites
psen01130  Biosynthesis of antibiotics
Module
psen_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:psen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PNC201_13320 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:psen01006]
    PNC201_13320 (ispA)
Enzymes [BR:psen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     PNC201_13320 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     PNC201_13320 (ispA)
Prenyltransferases [BR:psen01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   PNC201_13320 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AUJ70924
UniProt: A0A2K9JZS2
Position
3079234..3080133
Genome map
AA seq 299 aa AA seqDB search
MSKKLQEKLQFAKTRVENTVLHYFDSVLETEENIKAATRYSIENGGKRLRPFLVYCTGEL
FGAAPEDLDKAAAAIECVHSYSLVHDDLPAMDDDDLRRGRPTCHIQFDEATAILAGDALQ
TLAFELLSEHPFAVSHHAQIKMISVLAKASGLQGMIGGQALDIAATNRLITIDELERIHK
LKTGALLSCAVELGILCSDPERVSEQARDAIRTYGRAIGLAFQVRDDILDVEGDTFVLGK
PQGSDLEHNKSTYPALLGLEQAKEKAEHLIDEALEALTRINGNTEILADLAKYIIDREY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaaattacaagaaaagctccagtttgctaaaactcgtgtagaaaacaccgtt
ttacactattttgatagtgtgcttgaaactgaagagaatataaaagcggctacacgctat
agtatagaaaacggcggcaaacgcttgcgaccgtttttagtgtattgtactggtgaatta
tttggtgctgctccagaagatttagacaaagctgcagccgcaatagagtgtgtgcatagc
tactctttggtgcacgacgatttacctgctatggatgatgatgatctcagacgcggccgt
ccaacttgccacatccaattcgatgaggcgaccgcgattttagctggtgacgctctgcaa
acgctggcatttgaactgctaagtgaacatccattcgcggtaagccaccatgcccaaata
aaaatgatttcagtgctagccaaggcatcgggtctacaaggtatgataggcggtcaagca
ctcgatatagcagcaaccaatcgtttaattacgatagatgagctcgaacgtattcataag
ctaaaaacaggtgcactactaagctgtgcagtagaacttgggatcttatgtagcgatccg
gaacgtgtttcagagcaagcacgtgatgcgatacgtacttatggacgtgcaattggcctt
gcatttcaagtcagagatgacattcttgatgtagaaggtgacacatttgtgcttggtaaa
cctcaaggctctgatttagaacataataaatctacctatccagcattattggggttagaa
caagcaaaagaaaaagctgaacacttgatagatgaagctttagaagcgcttacacgtatc
aacggtaatacagaaatacttgcagatttagcaaaatacatcatagatcgagaatattaa

DBGET integrated database retrieval system