KEGG   Pseudoalteromonas sp. NC201: PNC201_13450Help
Entry
PNC201_13450      CDS       T05464                                 

Gene name
gshB2
Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
psen  Pseudoalteromonas sp. NC201
Pathway
psen00270  Cysteine and methionine metabolism
psen00480  Glutathione metabolism
psen01100  Metabolic pathways
Module
psen_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:psen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PNC201_13450 (gshB2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PNC201_13450 (gshB2)
Enzymes [BR:psen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     PNC201_13450 (gshB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AUJ70950
UniProt: A0A2K9K4U4
Position
3111136..3112164
Genome map
AA seq 342 aa AA seqDB search
MYPWERVEAENDSTLRLIHEAVSRGHVVAITTVNNLTIRESVASAFCDVFVAGQKVSDNL
VSFYNKAEFKKVQLPLAGFDAIFMRANPPLDTLAMNFLDSVRDDTFIINDIDGLRIANNK
LYTASFQGIAREFIPNTHVSKNKEYLERIFSESEQEKMILKPLDGFGGRGVIVVEKRAKQ
SFSSLLEFYIGGDEAGKGSNYVILQDYVEGADEGDVRILMLNGEPIGAMKRVPAANEVRA
NVHAGGKVVKHKLTNQEKALCKHIGPKLVRDGLYFVGIDVIGGKLIEVNVLSPGGITRIN
RLNRCKLQVQVIDFVESVVHAKELVTHRKNQFRQVIEDAHAI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtacccttgggagcgtgtagaagctgaaaacgacagcacgctaagacttatccacgaa
gccgtatcgcgcggtcacgtcgttgccatcaccaccgtaaacaacctcactattcgcgaa
agtgtcgccagtgccttctgtgatgtatttgttgcgggccaaaaagtatctgacaactta
gtgagcttttacaacaaagctgagtttaaaaaagtacagcttcctttggcaggttttgac
gcaatatttatgcgcgccaatccgccgcttgataccttggcgatgaactttttagactct
gttcgtgatgatactttcatcatcaacgacatcgatggcctgcgtatcgcaaataacaag
ctatacacggcatctttccaaggcatcgcgagagagtttattccaaatacgcatgtatct
aaaaacaaagagtatttagagcgtatattctctgaatcagagcaagagaaaatgatctta
aagccgcttgatggctttggcggtcgcggtgttatcgtcgttgaaaaacgcgcgaaacaa
agctttagctcactccttgagttttatattggtggcgacgaggctggtaaaggcagcaac
tacgtcattttacaagactatgttgaaggtgccgacgagggtgatgttcgtattctaatg
cttaacggcgaaccgattggcgccatgaaacgtgtgcctgcagcaaatgaagtgcgtgcc
aacgtacatgccggtggcaaagtagtgaaacacaaactcaccaaccaagaaaaagcgcta
tgtaagcacatcggccctaagcttgtgcgtgatggtttgtattttgttggcattgacgtg
ataggcggcaagcttattgaagttaacgtgctctcgcctggcgggataacccgtattaac
cgtttaaaccgctgtaagctgcaagtgcaagttatcgattttgtagagagtgtggtgcac
gccaaagagctagtaacgcatcgcaaaaaccaattccgtcaagtaatagaagatgctcat
gctatctga

DBGET integrated database retrieval system