KEGG   Pseudoalteromonas sp. NC201: PNC201_16345Help
Entry
PNC201_16345      CDS       T05464                                 

Gene name
murI
Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
psen  Pseudoalteromonas sp. NC201
Pathway
psen00471  D-Glutamine and D-glutamate metabolism
psen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PNC201_16345 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psen01011]
    PNC201_16345 (murI)
Enzymes [BR:psen01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     PNC201_16345 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:psen01011]
 Precursor biosynthesis
  Racemase
   PNC201_16345 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AUJ71491
UniProt: A0A2K9K3X2
Position
complement(3757806..3758582)
Genome map
AA seq 258 aa AA seqDB search
MSHILVFDSGIGGTSVLSHLKVCLQGGSFSYVMDNAFLPYGLQPQELIKSRIKGLIRWQQ
QYLGNVDLIVIACNTASTYALEEARKHTQIPIIGVVPAVKPAASSSKTKHIALLATPATS
NNAYTHKLIMDFTSGCKVETLHSTELVRIAEHFYWHNELDKEALCAEIDRLYIPATVDRL
VLGCTHFPLIAHDIKNCLQKHVELVDSGKAIANRAVSLLGSQIVVGEKVPSASEVRFYAT
APVMGSKEVISIINLNKD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcatattttggttttcgattcggggatcggtggcaccagtgtgctgtcgcactta
aaggtatgtttgcaggggggttcatttagttatgttatggacaacgcttttctcccatat
ggccttcagcctcaagagctaatcaaatcacgtatcaagggacttattcgttggcaacag
caatacttgggcaatgttgatcttatcgttattgcatgtaataccgcttcaacatacgcg
ttggaagaagccagaaaacatacccagattccaattataggtgttgttcctgctgttaag
cctgctgcgtctagttcaaagaccaagcacatcgcactattggcaacaccggcaacgtca
aataatgcttatacacataagctcatcatggattttacctcaggttgtaaagttgaaact
ttgcattcaacggagcttgtaaggatcgctgagcacttttattggcataacgagttggat
aaagaggcactttgcgcggaaatagaccggctttacattccagccactgttgataggcta
gtgttgggatgtacacattttccgttgatagctcacgatatcaagaattgcttacagaag
catgtggagctggttgattctggcaaagcaatagccaatcgcgcagtgtcattgttggga
agtcaaatagtagtaggagaaaaggtgccgagtgcatcggaagtgcgtttctatgcaacg
gcaccagtaatgggtagtaaagaagtaatctctattattaatttaaataaagattaa

DBGET integrated database retrieval system