KEGG   Pseudoalteromonas piratica OCN003: OM33_01635Help
Entry
OM33_01635        CDS       T03513                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00860  Porphyrin and chlorophyll metabolism
pseo01100  Metabolic pathways
pseo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OM33_01635
Enzymes [BR:pseo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     OM33_01635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C BET
Motif
Other DBs
NCBI-ProteinID: AIY63996
UniProt: A0A0A7ED38
Position
1:complement(382989..384359)
Genome map
AA seq 456 aa AA seqDB search
MQNFVEWDNSLIKKYNVSGPRYTSYPTALSFESGFSVDSVTQAIAKSDNTRLSLYIHVPF
CHQLCYYCGCNKIITRHQHKADVYLDFLEQEAKAQAALYKDYKIEQLHLGGGTPTFLTKE
QMSRLMAIVQTHFNFSDSVQSSIEIDPRSLPDDMLGHLRSLGFNRVSFGIQDFNDDVQKA
VNREQCADNVANLVSEARALGFSSVNADMIYGLPLQTPESFKESMARLIALSPDRVSVFN
YAHLPDRFAAQRKIKDEQLPSPDQKLSMFKNTLAQMMEAGYVNIGMDHFAKSTDSLAIAQ
QKGKLHRNFQGYTTHGDCDLLGLGASSISQVGDSIFQNPKDLKDYYQTVEASGVPVVKGL
TLTKDDKIRAFVIKEIICHFKLNFADVEHKFAINFADYFADELGGLTCFSEDGMVSLNEE
ALIVENKGRLFIRNICMTFDAYLKQQAKLTRFSRVI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaatttcgtcgaatgggataattcccttataaaaaaatacaatgtgtcaggtcct
cgttatacttcctatccaacggcgttgtcgtttgagtctggcttttctgttgattcggta
acacaggcgattgccaaaagcgataatacgcgcttgtcgctgtatattcatgtaccgttt
tgtcaccagctttgctattactgcggctgtaataaaataattactcgccaccaacataaa
gcagatgtctatttagactttttagagcaagaagcaaaggcacaagcggcgctttataaa
gattataaaattgagcagttacatttaggtgggggtactccaacctttttaacaaaggaa
caaatgagccgtttaatggcgattgttcaaacgcatttcaacttttcagattcagtgcaa
tcaagcattgaaattgatcctcgttctttacctgatgatatgcttggccacttacgctcg
cttggatttaatcgagtatcttttggcattcaagactttaatgatgacgtgcaaaaagcg
gtaaatcgtgaacaatgtgcagataacgttgcaaaccttgtgagtgaagcgcgtgccctc
ggtttttcatcggtcaatgcggatatgatttatgggcttccattgcaaacacctgagagc
tttaaagagagcatggcgcgattaattgcactctcgcctgatcgtgtatcggtatttaac
tatgctcatttaccggatcgctttgctgcacaacgtaaaattaaagacgagcaattacca
agtccagatcaaaagctatcgatgtttaaaaacaccttggcgcaaatgatggaagctgga
tacgtaaatatcggtatggatcatttcgctaaaagcactgattcgctcgcgattgcacag
caaaaaggtaagttacaccgtaacttccagggttatacaacccatggcgactgtgactta
ttagggttaggagcatcctctatttcacaagtaggtgatagtatcttccaaaatccaaaa
gatttgaaagactattatcaaaccgttgaagcatcaggtgtgccagttgttaaggggctt
actttaaccaaggatgataaaattcgcgcctttgttattaaagaaattatttgccacttt
aagctaaattttgctgatgttgagcataagtttgcaattaactttgcagattattttgct
gatgagctcggtggacttacgtgtttttctgaagatggcatggtctcattaaatgaagaa
gcacttattgttgagaacaaagggcgcttgtttattcgtaatatatgcatgacttttgat
gcatatttaaaacagcaagcaaaactaacacgcttttctcgtgtgatttaa

DBGET integrated database retrieval system