KEGG   Pseudoalteromonas piratica OCN003: OM33_05545Help
Entry
OM33_05545        CDS       T03513                                 

Definition
(GenBank) dUMP phosphatase
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00230  Purine metabolism
pseo00240  Pyrimidine metabolism
pseo00760  Nicotinate and nicotinamide metabolism
pseo01100  Metabolic pathways
pseo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OM33_05545
   00240 Pyrimidine metabolism
    OM33_05545
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    OM33_05545
Enzymes [BR:pseo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     OM33_05545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AIY64665
UniProt: A0A0A7EDD6
Position
1:1227646..1228338
Genome map
AA seq 230 aa AA seqDB search
MKYQWIVFDADETLFHFDAFAGLKQLFSHYNIVFEKSDFDEFQTVNKPLWIDYQNGTISA
KELQVRRFTAWGEKLDVDPVLLNQQFIEAMADICQCLPGARKLLELLQGKAKLAIITNGF
TALQKVRLARTDLTHFFEHVIISEQVGVAKPNIAIFDHALSLFGDPDKSSVLMVGDTLSS
DILGGKNAGLDTCWINHEGEKVEDTVGATYQVGCLTGLYNLIKSFETEHV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaagtaccaatggattgtttttgatgcagatgaaaccttgttccattttgatgcgttt
gcgggcttaaaacagcttttttcacattataatatcgtgtttgaaaagtcagattttgat
gaatttcaaaccgttaataaaccactatggattgattatcaaaatggcactattagcgcg
aaagagctacaagttaggcgctttactgcttggggggaaaagctagacgtagatcctgtg
ctgctaaatcaacagtttattgaagcgatggctgatatttgtcagtgcttacctggtgct
cgtaaactgctggaattacttcaaggcaaagcaaagcttgcgattattacgaatggtttt
actgcgctgcaaaaagttcgtttggcgcgaactgacttaacccatttttttgaacatgtg
attatttcagagcaggtcggtgtggcaaaaccaaatattgctatttttgatcatgcgcta
agtttgttcggcgaccctgataaatcatcggtgttaatggtcggtgataccctgagttct
gatattttaggtggtaaaaatgccggcctagatacatgctggataaaccatgaaggggaa
aaagtggaagacactgttggggcaacatatcaagttggttgcttaacagggctttataat
ttgattaagtcatttgaaaccgaacacgtttaa

DBGET integrated database retrieval system