KEGG   Pseudoalteromonas piratica OCN003: OM33_06190Help
Entry
OM33_06190        CDS       T03513                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
pseo  Pseudoalteromonas piratica OCN003
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    OM33_06190 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIY64781
UniProt: A0A0A7EFE6
Position
1:complement(1362220..1362603)
Genome map
AA seq 127 aa AA seqDB search
MTTSSNSPIKVSVETFYVDGQSEPEKDKFVFAYTITIKNHSLCATKLLSRYWLITDANGK
ETEVEGEGVVGETPTIGPGESYTYTSGAVLDTPIGTMQGYYNMRNEFGNEFQAPINVFRL
ASNVALH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagcagtaattctccaattaaggtctctgttgagactttttatgtcgatggg
caatctgaacctgaaaaagataaatttgtttttgcctatacgattacaatcaaaaaccac
agcttatgtgcgaccaaacttcttagccgatattggttgattacagatgctaatggcaaa
gaaactgaagttgaaggcgaaggtgttgtgggtgaaactccaactatcggcccaggtgaa
agttatacttacacttcaggtgcagttttagataccccaataggtactatgcaaggttat
tacaacatgcgtaacgagtttggcaatgaatttcaagcgcctataaacgtatttcgcctt
gcgagtaacgtagcgctccactaa

DBGET integrated database retrieval system