KEGG   Pseudoalteromonas piratica OCN003: OM33_10720Help
Entry
OM33_10720        CDS       T03513                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00071  Fatty acid degradation
pseo00072  Synthesis and degradation of ketone bodies
pseo00280  Valine, leucine and isoleucine degradation
pseo00310  Lysine degradation
pseo00362  Benzoate degradation
pseo00380  Tryptophan metabolism
pseo00620  Pyruvate metabolism
pseo00630  Glyoxylate and dicarboxylate metabolism
pseo00640  Propanoate metabolism
pseo00650  Butanoate metabolism
pseo00900  Terpenoid backbone biosynthesis
pseo01100  Metabolic pathways
pseo01110  Biosynthesis of secondary metabolites
pseo01120  Microbial metabolism in diverse environments
pseo01130  Biosynthesis of antibiotics
pseo01200  Carbon metabolism
pseo01212  Fatty acid metabolism
pseo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OM33_10720
   00630 Glyoxylate and dicarboxylate metabolism
    OM33_10720
   00640 Propanoate metabolism
    OM33_10720
   00650 Butanoate metabolism
    OM33_10720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OM33_10720
   00072 Synthesis and degradation of ketone bodies
    OM33_10720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OM33_10720
   00310 Lysine degradation
    OM33_10720
   00380 Tryptophan metabolism
    OM33_10720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OM33_10720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OM33_10720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OM33_10720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pseo04147]
    OM33_10720
Enzymes [BR:pseo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OM33_10720
Exosome [BR:pseo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OM33_10720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Ketoacyl-synt_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIY65576
UniProt: A0A0A7EHN8
Position
1:2306277..2307473
Genome map
AA seq 398 aa AA seqDB search
MSVENSQIDPVVIVSAKRTAMGGFMGALSSVNATDLGATAIKSSIESCDLNADIIDEVIM
GCVLPAGLGQAPARQAMIKAGLNLATGATTINKVCGSGLKAAMLAHDLIKADSINVAVAG
GMESMSNAPYFLPKARGGFRMGHGEIKDHMMADGLEDAYDNKAMGCFAQETADKYGLTRD
DMDTFAISSLSKANAAIESGAFEAEIAPHTYSSRKGDVTVAIDEQPGNARPEKIPSLRAA
FAKDGTITAANSSSISDGAASLVLMKASKAAELGLTPLCEIKAHATNSHIPAEFTTAPIG
AMEKVLDKAGWSKEDVDLWEINEAFAMVTMLAINEMQLDNNKVNVNGGACALGHPIGASG
ARILVTLIHALKNRGLNKGVASLCIGGGEAVAMAIEVK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgaaaattctcaaatcgatccggtagtaattgtgagtgcaaaacgcactgca
atgggcggttttatgggtgctttatcatcggtaaatgcaactgatttaggagctactgct
attaaaagtagtattgaaagctgcgacttaaacgctgatatcatcgacgaagtaattatg
ggctgcgttttaccagcaggtcttggtcaagcaccagcacgtcaagcaatgataaaagca
gggcttaatttagcaacaggcgcaacaactattaataaagtatgcggttcaggcttaaaa
gcagcgatgttagctcatgacttaattaaagcagacagcattaatgttgcggttgctggc
ggtatggaaagcatgagtaatgcaccttacttcttaccaaaagcacgtggcggtttccgt
atgggccatggtgaaattaaagatcatatgatggccgatggtttagaagatgcgtacgac
aacaaagcaatgggttgttttgctcaagaaacagctgataaatatggcttaacccgtgat
gatatggatacgtttgccatttcatctctttctaaagccaacgctgcaattgaaagtggt
gcatttgaagctgaaattgcgccacatacctattcaagtcgtaaaggtgatgtgacagta
gcaatcgatgagcagccaggtaatgcccgtcctgaaaaaattccaagcctacgtgcagca
ttcgcaaaagatggcaccattacagcggcaaattcatcgtctatttctgacggtgcagcg
tcacttgttttaatgaaagcatctaaagcagcagagcttggtttaacaccactttgtgaa
attaaagcccatgcgacaaattcacatattccagctgaatttacgacagcgccaattggt
gcgatggaaaaagtgttagacaaagctggctggtccaaagaagacgttgatctttgggaa
attaatgaagcatttgccatggtaactatgcttgctattaacgaaatgcaacttgataac
aataaagtaaacgtgaatggtggtgcatgtgcacttggtcacccaatcggtgcaagtggc
gcacgtattttagtaacgcttattcatgcacttaaaaaccgtggcctaaataaaggcgtg
gcatcactgtgtattggtggtggtgaagcggttgcaatggcaatcgaagtaaaataa

DBGET integrated database retrieval system