KEGG   Pseudoalteromonas piratica OCN003: OM33_10940Help
Entry
OM33_10940        CDS       T03513                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00020  Citrate cycle (TCA cycle)
pseo00310  Lysine degradation
pseo00380  Tryptophan metabolism
pseo01100  Metabolic pathways
pseo01110  Biosynthesis of secondary metabolites
pseo01120  Microbial metabolism in diverse environments
pseo01130  Biosynthesis of antibiotics
pseo01200  Carbon metabolism
Module
pseo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pseo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OM33_10940
  09105 Amino acid metabolism
   00310 Lysine degradation
    OM33_10940
   00380 Tryptophan metabolism
    OM33_10940
Enzymes [BR:pseo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OM33_10940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_60s HlyD_3 Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 HTH_17
Motif
Other DBs
NCBI-ProteinID: AIY65617
UniProt: A0A0A7EI54
Position
1:complement(2350560..2352044)
Genome map
AA seq 494 aa AA seqDB search
MTTEIKVPVLPESVADATVATWHVNVGDTVSRDQNLVDIETDKVVLEVVAPEDGVITEIS
QTEGATVLGEQVIALLGAADAAAAPAETTAAPAAAPAAEGKEVDIKVPVLPESVADATIA
TWHVQPGEAVSRDQNLVDIETDKVVLEVVAPEDGVMGDHIHAEGDTVLGEQVIGKLVAGA
APAAAAPAATAEAPAASDENSDVLTPSVRRLIAEKGLDASQIKGSGKGGRITKEDVDAFL
KAPAAKPASAPAAAAPAVALGERTQKRVPMTRLRKTIANRLLEAKNSTAMLTTFNEVNMK
PIMDLRKQYKDVFEERHGIRLGFMSFYVKAVTEALKRFPEVNASIDGDDIVYHNYFDISI
AVSTPRGLVTPVLRDCDKLSVAEIEKGIRELALKGRDGKLTVDDMTGGNFTITNGGVFGS
LLSTPIINLPQSSILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRQIDGKESVGFLVTI
KELLEDPTRLLLDV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaaattaaggttcctgttcttcctgaatctgttgcagatgcaacagttgca
acttggcacgtgaacgttggtgatacagttagccgcgatcaaaaccttgttgatattgaa
acagataaagtagttttagaagtagttgcaccggaagatggtgtgattacagaaatttct
caaacggaaggtgcaacggtacttggtgaacaagtgattgcactattaggtgcggcagat
gcagcagctgcgccagcagaaacaacagcagcgccagcagcggcgccagcagcagaaggt
aaagaagtggatattaaagttcctgtacttccagaatcagtagcagacgctacgattgca
acatggcatgttcaaccaggtgaagcggttagccgtgaccaaaacctagtagacatcgaa
actgataaagttgttcttgaagttgtagcgccagaagatggtgtaatgggtgatcacatt
cacgcagaaggcgacacagtacttggcgaacaagtaattggtaaactagttgcaggtgca
gcacctgcggcggcagcgccagcagcaacagctgaagcgccagcagcatctgacgaaaac
tcagacgtgttaacgccttctgttcgtcgtctaattgcagaaaaaggtcttgatgcttca
caaatcaaaggttctggcaaaggcggtcgtatcacaaaagaagacgtagacgcattctta
aaagcacctgcagctaagcctgcttcagctcctgcggcggcagcgcctgcagttgcactt
ggtgagcgtacgcaaaaacgtgttcctatgacacgtcttcgtaagacaattgctaaccgt
cttctagaagctaagaattcaacagcaatgcttacaacgtttaacgaagtaaacatgaaa
ccaatcatggatcttcgtaagcaatacaaagatgtatttgaagagcgccacggcatccgt
ttaggttttatgtctttttacgtgaaagcagttactgaagcgcttaagcgtttccctgaa
gtaaacgcgtctatcgacggtgatgacattgtttatcacaactacttcgatatcagcatt
gctgtttctacgcctcgcggtctagtaacaccggtacttcgtgactgtgacaagctatct
gttgctgagattgaaaaaggtattcgtgaactagcacttaaaggtcgtgatggtaagtta
actgttgatgacatgacaggtggtaacttcactattacaaatggtggtgtatttggttcg
ttactatcaacgccaattatcaacctaccgcaatcatcaattcttggtatgcacaaaatc
caagaccgtccgatggctgtaaatggtaaagttgaaatcttacctatgatgtacttagcg
ttatcatatgatcaccgtcaaatcgatggtaaagaatctgtaggtttcttagtaactatt
aaggaactactagaagatccaacacgtttattactagacgtttaa

DBGET integrated database retrieval system