KEGG   Pseudoalteromonas piratica OCN003: OM33_11645Help
Entry
OM33_11645        CDS       T03513                                 

Definition
(GenBank) N-acetylglucosamine 6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00520  Amino sugar and nucleotide sugar metabolism
pseo01100  Metabolic pathways
pseo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OM33_11645
Enzymes [BR:pseo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     OM33_11645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AIY65726
UniProt: A0A0A7EI37
Position
1:complement(2497285..2498412)
Genome map
AA seq 375 aa AA seqDB search
MSVTTYFATRLFTGEQFLENVSFVVENGVISEFVNGQAAEAISLTGTVVPGFIDVQVNGG
GGAFFNAEQSVECVNKIAKAHGQFGTTALLPTLITDSVEVMERAADATAQAIKDKVPGIV
GVHFEGPHLSMPKKGTHSEKFIRPISEAEFAVFERQDLGIKVVTLAPENVSVADIKRLVN
AGVKVSIGHTNADYQTVLAALEAGADGFTHLYNAMSAFTSREPGVVGAALTDTNAWCGLI
VDGHHVHPVSAKFAIDSKTRGKIMLVTDAMPPVGTDDMEFDFFDGRKVIRTGDRLNSTTG
ELAGSVLDMAGAVRNTINTLDVSYAEALRMASLYPAQYLGLGTQKGRLVVGSDADFVVMS
DDYYAQDTFVGGAKR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgactacctattttgcgacccgcctttttacaggtgaacagtttttagaaaac
gtcagttttgttgttgaaaacggtgttatttccgagtttgtaaatggtcaagcagcagaa
gcaatttcacttactggtactgttgtgccgggttttattgatgtgcaagtcaatggtggc
ggcggtgcattctttaatgcagagcaaagcgttgagtgcgttaataaaattgcaaaagcg
catggccaatttggtacaacggcactcttacctacacttattacagacagtgtagaggta
atggagcgtgcagctgatgcaaccgctcaggcaattaaagataaagtgccaggtattgtc
ggtgtgcacttcgaaggcccacatttgtctatgccaaaaaaaggcacgcacagtgaaaaa
tttatccgtcctatttcagaagcggaatttgctgtttttgaacgtcaagatttaggcatt
aaagtagtcacacttgcccctgaaaatgtctctgttgcagatattaaacgtcttgttaat
gcgggtgtaaaagtatcgattggtcacaccaatgccgattatcaaacagtacttgctgcc
cttgaggctggcgcagatggctttacgcacttatacaatgcaatgagtgcgtttacctca
cgtgaaccaggtgtggtaggtgcagcacttacagataccaatgcatggtgtggcttaatt
gttgatggtcaccacgttcatcctgtttcggctaaatttgcgattgatagcaaaacccgt
ggcaaaattatgttagtgactgatgctatgccgcctgttggcacggatgatatggaattt
gatttcttcgatggtcgaaaagttattcgtactggcgatagacttaattcaacgacaggg
gagttagcgggcagtgttcttgatatggcaggtgctgttagaaacactatcaacactctt
gacgttagttatgctgaagcgcttcgtatggcatcactttacccagcacaatatttaggg
ctaggaacacaaaaaggacgattagtcgtcggttcagatgctgattttgtggtgatgagt
gatgattattatgcacaagatacttttgttggtggcgcgaaacgttaa

DBGET integrated database retrieval system