KEGG   Pseudoalteromonas piratica OCN003: OM33_12850Help
Entry
OM33_12850        CDS       T03513                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00790  Folate biosynthesis
pseo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OM33_12850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pseo04147]
    OM33_12850
Enzymes [BR:pseo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     OM33_12850
Exosome [BR:pseo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OM33_12850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AIY65917
UniProt: A0A0A7EIV2
Position
1:complement(2772710..2773051)
Genome map
AA seq 113 aa AA seqDB search
MSELSAQKCEACRADAPKVSDEELAVLVKQIPDWTPIVVDGIMQLERVFKFKNFKLALEF
TNKLGAMAEDEGHHPGILTEWGKVTVTWWSHSIKGLHKNDFICAAKTDALLED
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattaagtgcacaaaaatgtgaagcgtgtcgtgctgacgcaccaaaggtttca
gatgaagagctagcggttctcgttaagcaaattccagattggacgccaattgtggttgac
ggcattatgcagttagagcgtgtgtttaagtttaaaaactttaaactcgcattagaattc
acaaacaagttaggtgcgatggcagaagacgaaggtcaccacccaggcattcttactgaa
tggggcaaggtaaccgtaacttggtggagccactcaattaaaggtctgcataaaaatgac
tttatttgtgcagctaaaacagatgcactactagaagactaa

DBGET integrated database retrieval system