KEGG   Pseudoalteromonas piratica OCN003: OM33_18155Help
Entry
OM33_18155        CDS       T03513                                 

Definition
(GenBank) flavin reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00633  Nitrotoluene degradation
pseo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    OM33_18155
Enzymes [BR:pseo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     OM33_18155
  1.-  
   1.-.-  
    1.-.-.-  
     OM33_18155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AIY67004
UniProt: A0A0A7EK47
Position
2:complement(773842..774498)
Genome map
AA seq 218 aa AA seqDB search
MTHPIISDLTRRYTSKRYDANKKVSQADLDVILEAIRLSPSSINSQPWKIIVIESDAAKE
RMHNTFANKFQFNQPHIKTASHTLLFAYNPKYARTDYEKVIDTDIENGRTKPENKDQAFG
AFAFVDLNTNDDGNNAHWTKAQTYIALGNAMHTVARLGIDSTPMEGVDKDLISELFADEL
NGYICEVALAIGYHEASEDYNASLPKSRLAKEKVITIL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacacacccaattatttctgatttaacgcgtcgatatacaagtaaacgatatgatgca
aacaaaaaagtttcacaagcagaccttgatgtgatcctagaagcaattcgtctttcacca
tcatcgattaattcacagccttggaagattattgtcattgaatctgatgcagcgaaagaa
cgtatgcataatacatttgccaataagtttcagtttaatcaacctcacatcaaaacggca
tcacatactctattatttgcatacaaccctaagtatgctcgcactgattatgaaaaagta
attgatactgatattgaaaatggtcgaacaaagcctgaaaacaaagatcaagcctttggc
gcatttgcttttgtcgatttaaacaccaatgacgatggtaataatgcgcactggactaaa
gcacaaacttacattgcgcttggcaatgcgatgcatacagtcgcgcgtcttggcatcgat
tcaacacctatggaaggggtagataaagatttaatcagtgagttatttgccgatgaatta
aatggctacatttgtgaagtggcattagcaattggttatcatgaagcaagtgaagactac
aatgcatcactgccaaaatcacgtttagcaaaagaaaaagtgattactattttgtaa

DBGET integrated database retrieval system