KEGG   Pseudoalteromonas piratica OCN003: OM33_19070Help
Entry
OM33_19070        CDS       T03513                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00380  Tryptophan metabolism
pseo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    OM33_19070
Enzymes [BR:pseo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     OM33_19070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: AIY67167
UniProt: A0A0A7EMK0
Position
2:complement(962881..963726)
Genome map
AA seq 281 aa AA seqDB search
MTCPHHNYRELEKEIHTDFKDDMSYGDYLQLSQVLTAQKPLSDQHDEMLFIIIHQSSELW
LKLAGHELSAAIENLKNGDFGHAFKVISRVKQIFNQLTQSWNILSTLTPVDYLKFRDALG
HSSGFQSYGYRKLEFLLGNKNNELLKVHESDPVIHSELSAILNAPSLYDVTLSILAKQGL
NIDEGHLQRDKSQPYEKNESVLNAWLEVYKDADKYFELYELAEKLVDIEDSFQQWRFKHM
YTVQRIIGNKTGTGGSSGVAFLKKALDISFFPELFELRTKL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacttgccctcatcataactaccgtgaattagaaaaagagatacataccgattttaaa
gacgacatgtcttatggcgattacttacaattatcgcaagtgttaacagcacaaaagcca
ctgtcagatcaacatgatgaaatgttatttatcattatccatcaatctagtgagctttgg
ttaaaacttgcaggtcatgagctgagtgctgcaatagaaaacttgaaaaatggtgatttt
ggtcatgccttcaaagttatttcacgcgtaaaacaaatttttaatcaactgacccaatcg
tggaatattctttctacattaacacccgtagattacttaaagttcagagatgcgttaggg
cattcatctggttttcagtcatatggttaccgtaaattggaattcttactaggtaacaaa
aacaatgaattattaaaagtgcatgaaagcgatccggtaattcacagtgagctttcagcc
attttaaatgcgcctagcttatacgatgtgactttatctattcttgcaaagcaagggcta
aacattgatgaaggtcatttgcagcgcgataaaagccagccatatgaaaaaaatgagtca
gtactgaacgcatggctcgaagtatataaagatgcggataaatactttgagttatatgaa
ctcgctgagaaattagtggatatagaagacagttttcagcaatggcgttttaaacacatg
tacacagtgcagcgtattattggtaataaaacgggtacaggtggttcgtctggcgttgcg
tttttgaaaaaagcgcttgatattagctttttccctgaactttttgaactcagaaccaag
ctgtaa

DBGET integrated database retrieval system