KEGG   Pseudonocardia sp. EC080610-09: AD006_04375Help
Entry
AD006_04375       CDS       T04146                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00040  Pentose and glucuronate interconversions
pseq00053  Ascorbate and aldarate metabolism
pseq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AD006_04375
   00053 Ascorbate and aldarate metabolism
    AD006_04375
Enzymes [BR:pseq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AD006_04375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALL74736
Position
complement(898744..900357)
Genome map
AA seq 537 aa AA seqDB search
MTAPPTTRPTGAMIIGGAPVAGAGDDGISSTDPRTGTALEPAWPAASTGQLDRACALAAE
AFPVYRALPVERRAGFLERIADLLDERRDALVERAHAETALPVPRLTGEVGRTSGQLRLF
AEELRTGTWQGARIDPARPGRTPLPRADIRQRRIPLGPVAVFGASNFPLAFSTAGGDTAS
ALAAGCPVVVKAHQAHLGTAELVARAIAEAAADTGMPDGVFAQLVGSGTGIGAQLVADPR
IRAVGFTGSRAGGLAIAATAAARPVPIPVYAEMSSINPVVLLPGALAGRGAELGAAFAAS
LTLGAGQFCTNPGLLLAVEGPGLDAFVAAAADVVAGDTGATMLTTGIAGHYAAAGDAVAG
RPGVSERARGTRSGEAASGAARLLSVPAERFLADPQLQCEVFGATSLLVRCADLVELTAA
VAVLEGQLTATVHADAADHDAARRLLPLLEERAGRILFDGWPTGVEVGHAMVHGGPFPAT
TDPRSTSVGTLAIERFLRPVAYQDVPQALLPAELADDNPDRVWRRTDGEPGRGPVAD
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccccccacgacccgcccgaccggagccatgatcatcggtggcgcgccggtg
gccggtgctggcgacgacgggatcagttccaccgacccccgtaccgggaccgcgctggag
cccgcctggcccgcggcgtccaccggccagctcgaccgggcctgcgcactggccgccgag
gcgttcccggtctatcgggcgctcccggtggagcgccgggccggcttcctcgaacgcatc
gccgacctgctcgacgagcgccgggacgcgctggtcgagcgggcgcacgccgagaccgcc
ctgcccgtcccgcggctgaccggtgaggtcgggcgcaccagcggccagctgcgcctgttc
gccgaggagctgcggaccggcacctggcagggcgcccggatcgatcccgcccggcccggc
cgcacgccgctgccgcgggcggacatccggcagcgccggatcccgctcggtccggtcgcc
gtgttcggcgcgagcaacttccccctcgcgttctcgaccgcgggcggggacaccgcgtcc
gcgctggccgccggctgcccggtcgtcgtcaaggcgcaccaggcccacctcggtacggcc
gagctcgtggcccgcgcgatcgccgaggcggccgcggacaccggcatgccggacggcgtc
ttcgcccagctggtcggcagcggcactgggatcggcgcgcagctggtcgccgacccccgg
atccgcgcggtcggattcaccggctcccgcgccggcggcctcgcgatcgccgcgacggcc
gccgcccgcccggtcccgatcccggtctacgccgagatgagcagcatcaacccggtggtg
ctgctgcccggcgcgctggcggggcgcggcgccgagctaggcgccgccttcgccgcctcg
ctcacgctcggggccgggcagttctgcaccaaccccggcctgctgctggccgtcgagggc
ccggggctcgacgcgttcgtcgcggcggccgcggacgtggtggccggtgacaccggcgcg
accatgctcaccaccgggatcgccggccactacgccgccgccggtgacgcggtggccgga
cgtcccggtgtgtccgaacgggcccgtggcacccggtccggggaggccgcctccggggcc
gcgaggctgctctcggtaccggcggagcgcttcctcgccgacccgcagttgcagtgcgag
gtgttcggagccacgtccctgctggtcaggtgcgccgacctcgtcgagctcaccgcggcg
gtcgccgtgctggagggccagctgaccgcgaccgtgcacgccgacgccgccgaccacgac
gcggcccggcggttgctgccgctgctggaggagcgggcggggcgcatcctgttcgacggc
tggccgaccggggtcgaggtcgggcacgccatggtgcacgggggacccttccccgccacc
acggacccgcgcagcacctcggtggggaccctcgcgatcgagcggttcctccggccggtc
gcctaccaggacgtgccgcaggcactgctgcccgccgagctcgccgacgacaaccccgac
cgggtgtggcggcggaccgacggcgagcccggccgggggccggtcgccgactga

DBGET integrated database retrieval system