KEGG   Pseudonocardia sp. EC080610-09: AD006_09920Help
Entry
AD006_09920       CDS       T04146                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00020  Citrate cycle (TCA cycle)
pseq00480  Glutathione metabolism
pseq01100  Metabolic pathways
pseq01110  Biosynthesis of secondary metabolites
pseq01120  Microbial metabolism in diverse environments
pseq01130  Biosynthesis of antibiotics
pseq01200  Carbon metabolism
pseq01210  2-Oxocarboxylic acid metabolism
pseq01230  Biosynthesis of amino acids
Module
pseq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pseq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AD006_09920
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AD006_09920
Enzymes [BR:pseq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AD006_09920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALL75545
Position
complement(2071327..2073558)
Genome map
AA seq 743 aa AA seqDB search
MKLIYTYTDEAPALATHSFLPVIEAFAGQAGVDVETRDISLAARILAKFPDRLTDAQRVP
DSLAELGELAKTPDANIIKLPNISASIPQLKAAIKELQGAGYDVPDYPEDPRTDDEKAAR
AAYDAVKGSAVNPVLREGNSDRRAPASVKNFARKHPHSMGAWNSDSKSHVATMSDGDFRH
SEKSFTVAADGALRIEHVAADGTVTVLKDAVKVLAGEVIDGSVMRREALQAFLAEQVADA
KAKGVLFSVHLKATMMKVSDPKIFGHAVRAYFADVFAAYGDDLASVGADPDDGLASVLSA
LEKLPADKREAIEKAITAAYETGPALAQVDSSRGITNLHVPSDVIIDASMPAAIRSSGQM
WNADDATQDAKFVIPDSSYADLYDETVKHCIANGAFDPTTMGTVPNVGLMAQKAEEYGSH
DKTFEIVSAGTVRVVDAASGEEKLSHEVAEGDIWRACQTKDAPIRNWVGLAVDRARATGS
PAVFWLDSSRAHDAQLIAKVETYLGELDTDGLTIEILPVGEATRYTLERARKGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLQKENHLRWD
SLGEFLALAVSLEMLASKSPDPLRAKLLGQALDDATGLLLENGKSPSRKVNELDNRGSHF
YVAWYWAQALAEQTEDPELAAVFAPLAKALGEQEETILGELNGAQGDPVDLGGYYYVDRA
KADSVMRPSATLNAAIDGFAGRS
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatctacacgtacaccgacgaggcgccggcactggcgacccactccttcctg
ccggtcatcgaggccttcgccgggcaggccggggtcgacgtggagacccgtgacatctcg
ctggccgcgcgcatcctggcgaagttcccggaccggctgaccgacgcgcagcgcgtcccg
gactccctcgccgagctcggcgagctggcgaagaccccggacgccaacatcatcaagctg
ccgaacatcagcgcctcgatcccgcagctcaaggccgcgatcaaggaactgcagggcgcc
ggctacgacgtcccggactaccccgaggacccgcggaccgacgacgagaaggccgcccgc
gccgcgtacgacgccgtcaagggctccgcggtgaaccccgtcctgcgcgagggcaactcc
gaccgccgcgccccggcgtcggtgaagaacttcgcccggaagcacccgcactcgatgggc
gcctggaactccgactcgaagtcccacgtcgcgaccatgtccgacggtgacttccggcac
tccgagaagtccttcaccgtcgcggccgacggcgcgctgcggatcgagcacgtcgccgcc
gacggcaccgtcaccgtcctcaaggacgcggtgaaggtcctggccggcgaggtgatcgac
ggctcggtcatgcggcgcgaggcgttgcaggcgttcctcgccgagcaggtcgccgacgcg
aaggcgaagggtgtgctgttctcggtgcacctcaaggccacgatgatgaaggtctccgac
ccgaagatcttcgggcacgcggtgcgcgcctacttcgccgacgtgttcgccgcctacggc
gacgacctcgcctcggtcggcgccgacccggacgacgggctggcctcggtgctgtccgcg
ctggagaagctgcccgccgacaagcgcgaggccatcgagaaggcgatcaccgccgcgtac
gagaccggcccggcgctggcccaggtcgactcgtcgcgcgggatcaccaacctgcatgtc
cccagcgacgtcatcatcgacgcgtcgatgccggccgcgatccggtcctcgggccagatg
tggaacgccgacgacgcgacgcaggacgccaagttcgtcatcccggactcgtcctacgcc
gacctgtacgacgagaccgtcaagcactgcatcgccaacggtgccttcgacccgacgacg
atgggcaccgtcccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcgcac
gacaagaccttcgagatcgtctccgcgggcaccgtccgcgtggtcgacgccgcctccggc
gaggagaagctctcccacgaggtcgccgagggcgacatctggcgcgcctgccagaccaag
gacgccccgatccgcaactgggtcgggctggccgtcgaccgggcccgcgccaccgggtcc
ccggccgtgttctggctggactcctcgcgcgcccacgacgcgcagctgatcgccaaggtc
gagacctacctgggcgagctcgacaccgacggtctgaccatcgagatcctcccggtcggc
gaggccacccggtacaccctggaacgggcacgcaagggcgaggacaccatctcggtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctcgagctgggcacctcg
gcgaagatgctctcgatcgtcccgctgatgaacggtggcggcctgttcgagaccggcgcc
ggcggttcggcgccgaagcacgtccagcagctgcagaaggagaaccacctgcggtgggac
tccctcggcgagttcctggcgctggccgtctcgctggagatgctggcgtcgaagtcgccg
gacccgctgcgcgcgaagctgctgggccaggcactcgacgacgcgaccggcctgctcctg
gagaacgggaagtcgccgtcccgcaaggtcaacgagctggacaaccggggcagccacttc
tacgtcgcgtggtactgggcccaggcgctcgccgagcagaccgaggacccggagctggcc
gcggtgttcgccccgctggcgaaggccctcggcgagcaggaggagaccatcctcggtgag
ctgaacggcgcgcagggcgacccggtcgacctcggcggctactactacgtggaccgcgcg
aaggccgactcggtgatgcgtccgagcgcgaccctcaacgccgcgatcgacgggttcgct
ggcaggagctga

DBGET integrated database retrieval system