KEGG   Pseudonocardia sp. EC080610-09: AD006_13475Help
Entry
AD006_13475       CDS       T04146                                 

Definition
(GenBank) cytochrome P450
  KO
K17476  pentalenolactone synthase [EC:1.14.19.8]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq01100  Metabolic pathways
pseq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    AD006_13475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pseq00199]
    AD006_13475
Enzymes [BR:pseq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.8  pentalenolactone synthase
     AD006_13475
Cytochrome P450 [BR:pseq00199]
 Cytochrome P450, bacteria type
  CYP161 family
   AD006_13475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: ALL76062
Position
2827440..2828651
Genome map
AA seq 403 aa AA seqDB search
MTLAAERPQLPFARPNILDLAPFYEVLRREAPVAPVTTPAGDPAWLVTRFSEVRDLLGDK
RFGRSHPEPEKASRISTAAVQDGPTGDYASEADEHARMRRLLTPAFSAKRMRRLSGHVQE
LVDGYVDALLADHDTAADGVVDLHAHLAFPLPVAVICTLLGVPESDGEYFRALSDRMATF
SGQDAHDARTEFGRYMAGLAEGKRAAPAEDVISDLVQAQADDETFGYPEMVRLCVGLLFA
GHETTVNRIGLGLLFLMNNRDQWDALVADPDGRIDAVIEEIMRLGAPGDLGLLRYAHTDV
EIGGVTIERGDALILSINAANRDTGVFADAETFDPDRGERGHIGFGHGPHFCIGASLART
ELRAVFVTLARRVPELRLAIGMDELDIRTDHLTGGVRSLPVQW
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgccgccgaacgcccgcagctcccgttcgcccgccccaacatcctcgacctg
gccccgttctacgaggtgctccgccgggaggccccggtcgccccggtgaccacccccgcc
ggtgaccccgcctggctggtgacccggttctccgaggtccgcgacctgctgggggacaag
cggttcggccggtcccacccggagcccgagaaggcgtcccggatcagcaccgcggccgtg
caggacgggccgaccggcgactacgcctccgaggccgacgagcacgcccggatgcgccgc
ctcctcaccccggcgttctccgcgaagcggatgcgacggctgtccgggcacgtccaggag
ctggtcgacggttacgtcgacgccctgctcgccgaccacgacacggctgcggacggcgtc
gtcgacctgcacgcgcacctcgccttcccgctgccggtcgcggtgatctgcaccctgctc
ggcgtccccgagtccgacggcgagtacttccgcgcgctgtcggaccggatggccaccttc
tccggccaggacgcgcacgacgcccggaccgagttcggccgctacatggcgggcctcgcc
gagggcaagcgcgccgcaccggccgaggacgtcatcagcgacctcgtgcaggcgcaggcc
gacgacgagacgttcggctacccggagatggtgcggctctgcgtcgggctgctgttcgcc
ggccacgagacgacggtgaaccggatcggcctcggcctgctgttcctcatgaacaaccgc
gaccagtgggacgccctggtcgccgacccggacggccggatcgacgccgtgatcgaggag
atcatgcgcctcggggcgccgggcgacctcggcctgctccgctacgcgcacaccgacgtc
gagatcggcggcgtgacgatcgagcgcggcgacgcgctgatcctgtcgatcaacgcggcg
aaccgggacaccggcgtcttcgccgacgccgagaccttcgacccggaccgcggcgagcgc
gggcacatcgggttcggccacggcccgcacttctgcatcggcgcgagcctcgcccgtacc
gagctgcgcgccgtgttcgtcacgctcgcccgccgggtcccggagctgcgcctggcgatc
gggatggacgagctcgacatccgcaccgaccacctcaccggcggcgtccgcagcctgccg
gtgcagtggtga

DBGET integrated database retrieval system