KEGG   Pseudonocardia sp. EC080610-09: AD006_16715Help
Entry
AD006_16715       CDS       T04146                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AD006_16715
Enzymes [BR:pseq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AD006_16715
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AD006_16715
    1.1.1.-  
     AD006_16715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALL76546
Position
3513823..3514875
Genome map
AA seq 350 aa AA seqDB search
MRAVVYRGPGQLDITDVPEAPVGAGEVRLKVGFNGICGSDLHEYYAGPIFIPNGEKHPLT
GRELPLTLGHEFSGTVVEVGSGVDGVETGDRVAVMPLYTCGTCARCSEGRYNVCATIGFH
GLMADGGMAESTVVPAHMLHKLPDDVSLEMGALVEPMAVAYHAAKLGDVQPGATALVFGA
GPIGIGLWFALRGTGVDNVRVVEPSPTRRQAIERLGADTLDPTAVDVPAVVADLTNGRGA
DACYDAAGVAPAVATALDSLGAGRPMVSVAIYETPLVTPLLNLVLGESRIQGSLCYTHED
YRAVIELMANGHYDTTGWMEKIAMADVVEEGFEALHAGRKMKVLVDPSVA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggtcgtctaccggggccccggacagctcgacatcaccgacgtgcccgaggca
cccgtcggcgccggggaggtgcggctgaaggtcgggttcaacggcatctgcggttccgac
ctgcacgagtactacgccggccccatcttcatcccgaacggcgagaagcacccgctgacc
ggccgcgagctgccgctgaccctgggccacgagttctccggcaccgtcgtcgaggtcggg
tccggggtcgacggcgtcgagaccggcgaccgggtcgcggtgatgccgctctacacctgc
gggacctgcgcgcggtgcagcgagggccgctacaacgtctgcgcgacgatcggcttccac
ggcctgatggccgacggcggcatggccgagtcgaccgtcgtcccggcgcacatgctgcac
aagctccccgacgacgtgtcactggagatgggcgccctcgtcgagccgatggcggtggcc
taccacgcggcgaagctcggcgacgtgcagccgggcgcgaccgcactggtgttcggcgcg
ggcccgatcgggatcgggctgtggttcgcgctgcgcgggacgggcgtcgacaacgtccgg
gtggtcgagccgtcgccgacccgcaggcaggcgatcgagcggctcggcgccgacaccctc
gacccgaccgccgtggacgtgcctgcggtcgtcgccgacctgacgaacgggcggggcgcc
gacgcctgctacgacgccgccggcgtggcccccgccgtcgcgaccgccctcgactccctg
ggcgcgggacggccgatggtcagcgtcgcgatctacgagacgccgctggtgacgccgctg
ctcaacctcgtgctgggcgagtcccggatccagggctcgctctgctacacccacgaggac
taccgcgccgtcatcgagctcatggcgaacgggcactacgacacgaccggctggatggag
aagatcgccatggccgacgtcgtggaggaggggttcgaggccctccacgccggccggaag
atgaaggtcctggtcgacccctccgtggcctga

DBGET integrated database retrieval system