KEGG   Pseudonocardia sp. EC080610-09: AD006_20940Help
Entry
AD006_20940       CDS       T04146                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00010  Glycolysis / Gluconeogenesis
pseq00030  Pentose phosphate pathway
pseq00051  Fructose and mannose metabolism
pseq00680  Methane metabolism
pseq00710  Carbon fixation in photosynthetic organisms
pseq01100  Metabolic pathways
pseq01110  Biosynthesis of secondary metabolites
pseq01120  Microbial metabolism in diverse environments
pseq01130  Biosynthesis of antibiotics
pseq01200  Carbon metabolism
Module
pseq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AD006_20940
   00030 Pentose phosphate pathway
    AD006_20940
   00051 Fructose and mannose metabolism
    AD006_20940
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AD006_20940
   00680 Methane metabolism
    AD006_20940
Enzymes [BR:pseq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AD006_20940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ALL77164
Position
complement(4544290..4545231)
Genome map
AA seq 313 aa AA seqDB search
MQAADLSTLEAVALAATRSAAVAGYAWVGRNDQKAADAAATTAMRTALAAAPGRGTVVIG
EGEKDDAPMLFNGEVVGTGHGPDFDIAVDPLEGTSFCARDLPGSLATIAFGDTGTLWSPG
PGFYMDKIVVPPAAKDVVDLDAPPEQTVADVAAALGKDVADLRVVIMDKPRHTELIERVL
RTGAAVQTPAGGDVGGALAVLMPTHDLDLLLGVGGTPEGVMTAAAVRALGGGMLGRLAPQ
RDDEADAIRAAGMSLDRVYDGTELAAGEAFFAASGVNGGPLLARPHIRDGTTVVESLLIS
RGQIRHITHTTFD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgctgacctcagcacgttggaagcggtggcgctggccgccacccgcagcgcc
gccgtggccggctacgcctgggtcggccgcaacgaccagaaggccgccgacgcggcggcg
accacggcgatgcgcacggccctcgccgccgcaccgggccgggggaccgtcgtcatcggg
gagggggagaaggacgacgccccgatgctgttcaacggcgaggtggtcggcaccggccac
ggaccggacttcgacatcgccgtcgatcccctcgaggggacctcgttctgcgcgcgggac
ctgcccggctcgctggccacgatcgccttcggcgacaccggcacgctctggtcgccgggg
ccaggtttctacatggacaagatcgtcgtgcccccggccgcgaaggacgtcgtcgatctc
gacgccccgcccgagcagaccgtggccgacgtcgccgcggcactcgggaaggacgtcgcc
gacctgcgggtcgtcatcatggacaagccgcggcacacggagctgatcgagcgcgtgctc
cggacgggcgctgcggtccagacaccggcgggcggcgacgtcggcggtgccctggcggtg
ctgatgccgacccacgacctcgacctgctcctcggggtcggcggcacaccggagggggtc
atgacggccgcggcggtccgggcgctcggcggcggcatgctgggccgcctggccccgcaa
cgtgacgacgaggcggacgcgatccgcgcggcgggcatgtccctcgaccgcgtctacgac
ggtaccgagctcgcggcgggtgaggccttcttcgccgcctccggggtcaacggcgggccg
ctgctcgcccggccgcacatccgcgacggcacgaccgtggtcgagtcactgctgatctcc
cgaggtcagatccgccacatcacccacaccaccttcgactga

DBGET integrated database retrieval system