KEGG   Pseudonocardia sp. EC080610-09: AD006_22180Help
Entry
AD006_22180       CDS       T04146                                 

Definition
(GenBank) hypothetical protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00361  Chlorocyclohexane and chlorobenzene degradation
pseq00625  Chloroalkane and chloroalkene degradation
pseq01100  Metabolic pathways
pseq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AD006_22180
   00361 Chlorocyclohexane and chlorobenzene degradation
    AD006_22180
Enzymes [BR:pseq01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AD006_22180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like HAD DUF3509
Motif
Other DBs
NCBI-ProteinID: ALL77339
Position
4826307..4826969
Genome map
AA seq 220 aa AA seqDB search
MALTTVVFDVNETLSDLTPLGKKFSDLGVPGWLGPYWFASTLREGIALAAGGELRTFSEI
GTDTAARLLRRHGVRWADVRAGEVLDGFLELPVHPDVHDGVAALRAAGLRLVTLSNGAAA
VAERLLGGHGLREQFDRVLSVEDAGIWKPAPAAYTYALRTCGIDASEAVMVAVHPWDLHG
AARTGMATAWLNRTGEPWPGHLTPPTFTVRALPELAGRLA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgaccgtggtgttcgacgtcaacgagaccctctccgacctcacgccgctc
gggaagaagttctccgatctcggcgtgcccggctggctcggcccctactggttcgcctcc
accctgcgggagggcatcgcgctggccgcgggcggggagctccggaccttctccgagatc
gggaccgacaccgcggcccggctgctgcgccggcacggcgtgcgctgggccgacgtccgg
gccggggaggtcctggacgggttcctggaactgccggtgcaccccgacgtccacgacggc
gtcgccgcactgcgggccgcgggcctgcggctggtcacactgtcgaacggcgccgcggcc
gtcgccgagcggctcctcggcggccacgggctgcgtgagcagttcgaccgggtgctgtcg
gtcgaggacgccgggatctggaagcccgcccccgccgcctacacctacgcgctgcgcacc
tgcgggatcgacgcgtccgaggcggtgatggtcgcggtgcacccgtgggacctgcacggg
gccgcccggaccgggatggcgacggcgtggctgaaccgcaccggcgagccatggcccggc
cacctcacgccaccgaccttcaccgtccgggcgctgcccgagctggcgggccggctggcc
tga

DBGET integrated database retrieval system