KEGG   Pseudonocardia sp. EC080610-09: AD006_27510Help
Entry
AD006_27510       CDS       T04146                                 

Definition
(GenBank) segregation protein A
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00450  Selenocompound metabolism
pseq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AD006_27510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pseq03016]
    AD006_27510
Enzymes [BR:pseq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     AD006_27510
Transfer RNA biogenesis [BR:pseq03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    AD006_27510
 Prokaryotic Type
    AD006_27510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ALL78113
Position
complement(5987067..5988101)
Genome map
AA seq 344 aa AA seqDB search
MSDRATTRRLTEYSHGAGCGCKLGPGQLAEVLAGVTPPSHPDLLVGTDTGDDAAVWRLSP
DRALVATTDFFTPIVDDARTWGAIAATNAVSDVYAMGGTPLFALNLVCWPSEDLGPDVLA
EVLEGGAGVGRDCGFAVVGGHTIDDPEPKYGLAVVGEVHPERVLTNAGLRPGDELVLTKP
LGIGVVTTAVKRGVPAAVEAAVAAMTTPNADAARAARDAGATGCTDVTGYGLLGHLTKMT
VASGVDARVDAGAVPLLDGVRELVAGGVVPGGTLRNRQWVDDRIVRTSASDDEVLLLSDA
QTSGGLLFGAAPGAAGTAVRWLRERGHPAAVIGSVTAGTGLVHV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccgtgcgaccacgcgccggctcaccgagtacagccacggcgcgggctgcggg
tgcaagctcggcccgggacagctggccgaggtgctcgccggggtgaccccgccgtcgcac
ccggacctgctggtggggacggacaccggggacgacgcggccgtctggcggctgtcgccg
gaccgtgcgctggtcgcgaccaccgacttcttcaccccgatcgtcgacgacgcgcgcacc
tggggggcgatcgccgcgaccaacgccgtgtcggacgtctacgcgatgggcggcaccccg
ctgttcgcgctgaacctggtgtgctggccgtcggaggacctcggcccggacgtgctcgcc
gaggtgctcgagggcggcgccggcgtcggccgggactgcgggttcgccgtcgtcggcggg
cacacgatcgacgacccggaaccgaagtacggcctcgccgtcgtcggggaggtccacccg
gagcgggtgctgaccaacgcgggcctgcgccccggcgacgagctggtcctgaccaagccg
ctcgggatcggcgtcgtcaccaccgccgtgaagcgcggtgtcccggccgcggtcgaggcc
gccgtcgccgcgatgaccaccccgaacgccgacgccgcgcgggccgcccgggacgcgggt
gcgaccggctgcaccgacgtcaccggttacgggctgctcggccacctcacgaagatgacc
gtcgcctccggtgtggacgcccgcgtcgacgcgggcgccgtgccgctgctcgacggcgtc
cgggagctcgtcgccggcggcgtcgtccccggcggaacgctgcgcaaccggcagtgggtg
gacgaccggatcgtgcgcacgtccgcgtccgacgacgaggtgctgctgctctccgacgcc
cagacctccggcgggctgctgttcggcgccgcgcccggcgccgcgggcacggccgtccgg
tggctgcgcgagcgggggcacccggccgcggtgatcgggtccgtcaccgcggggaccggt
ctggtccacgtctag

DBGET integrated database retrieval system