KEGG   Pseudanabaena sp. ABRG5-3: ABRG53_3414Help
Entry
ABRG53_3414       CDS       T05820                                 

Gene name
chlN
Definition
(GenBank) light-independent protochlorophyllide reductase, N subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
pser  Pseudanabaena sp. ABRG5-3
Pathway
pser00860  Porphyrin and chlorophyll metabolism
pser01100  Metabolic pathways
pser01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pser00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABRG53_3414 (chlN)
Enzymes [BR:pser01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     ABRG53_3414 (chlN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: BBC25671
UniProt: A0A2Z5X1V5
Position
complement(3791986..3793275)
Genome map
AA seq 429 aa AA seqDB search
MALEPCTEVPAINTQKINTDLAVLKERGQREVFCGLTGIVWLHRKMQDAFFLVVGSRTCA
HLIQSAAGVMIFAEPRFGTAILGERDLAGLADANEELDRVVDQLLERRPDIGTLFLVGSC
PSEVIKLDLAKASERLNQRFFPKVRILNYSGSGIETTFTQGEDACLGSMVPVLPHSQDEP
SLMVVGSLADVVEDQFQRLFDKLGIPVSFFPPRRAAKLPPIGKGTKLLLAQPFLSDTVRS
LISRGATLLPSPYPFGIEGTTAWLKTAADAWNVDKEKFEEAIAPQVNRAKIALERYRQVL
TGRKAFLFPDSQLEIPLARFLSRECGMELVEVGTPYIDRLLMDSEINLLPVGTALSEGQD
VEKQLDRCREARPDITVCGLGLANPLEAEGMATKWSIELVFSPIHGYDQAADLAELFARP
LERRRRLTV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctctagagccttgcacagaagttcctgctatcaatactcaaaaaataaacaccgat
cttgccgtgctcaaagagcggggacagagggaggtgttttgtggcttgacgggaatcgtc
tggttacaccgcaaaatgcaggatgcttttttcttagtcgtaggttcacgaacctgcgcc
cacttgattcagtctgcggctggagtgatgatttttgctgaaccaagattcggaactgcg
attctcggtgaacgcgatctagcgggtcttgcagatgcaaatgaagaacttgatcgcgtt
gttgatcagttactagagcgtcgtcctgatattggcactctctttttagtgggatcatgt
ccctctgaagtgattaagctcgatcttgccaaggcttctgaacgtctcaatcagcgattc
tttcccaaagttagaattcttaattattcaggtagtggcattgaaactacctttactcaa
ggcgaagatgcttgtttaggatcaatggttcctgtcctgccccatagccaagatgaaccc
agtctaatggtggtaggtagtcttgccgatgtggtagaagatcagttccaaagactattc
gataaattaggcattcctgtgagtttctttccgccgcgtcgtgctgccaaattgccaccg
attggcaaagggacaaaactactgttagctcaaccttttctgagtgacacagtgcgatcg
ctgatttcacggggtgcgacattattaccatcgccctatccctttggtatcgagggtaca
accgcatggctaaaaacagccgcagatgcttggaatgtggataaggagaaatttgaagag
gcgatcgctcctcaagtgaatcgcgccaaaattgccctagagcgatatcgccaagtcttg
acaggtcgcaaagcctttctattccccgactcacaattggaaattccattggctcgtttt
ctctctagagaatgcggcatggagctagtcgaagtaggcacgccctatattgatcgcctg
ttaatggatagtgaaattaatctgttaccagtcggtacagccctttcagaaggtcaggat
gtagaaaagcaacttgatcgttgccgtgaagcccgtcctgatattaccgtctgtggtcta
ggacttgcgaaccctctcgaagcagaaggtatggctacaaaatggtcaattgaattagtg
ttttcgccaattcacggttacgaccaagccgccgatttagcagagctatttgctcgtcca
cttgagagaagaagaagattaactgtctaa

DBGET integrated database retrieval system