KEGG   Pseudanabaena sp. ABRG5-3: ABRG53_3980Help
Entry
ABRG53_3980       CDS       T05820                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pser  Pseudanabaena sp. ABRG5-3
Pathway
pser00520  Amino sugar and nucleotide sugar metabolism
pser01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pser00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ABRG53_3980
Enzymes [BR:pser01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     ABRG53_3980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: BBC26237
UniProt: A0A2Z5X462
Position
complement(4410876..4411811)
Genome map
AA seq 311 aa AA seqDB search
MKILVTGGAGFIGSHLVDRLIEAGNSVISLDNLYTGRKVNNAHWLEHPNFKFIEHDVINP
IDIEQVDQIYHLACPASPVHYQADPIKTAQTNFLGTFNVLELAKRCKARVLLASTSEVYG
DPLIHPQTEDYWGNVNCTGIRSCYDEGKRISETLTFDYHRQFGVEVRVARIFNTHGVRML
ENDGRVVSNFIVQALKGIPLTIYGDGSQTRSFCYVSDLVEGLIRLTNGNYIGPVNLGNPG
EYTILQLAQTIQRLIDPTAELVFKPLPQDDPQRRQPDISRAKFHLGWEPTVPLEEGLAKT
IAYFRDHLSVK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttggttactggcggtgcgggctttattgggtcacatttagttgatcgtctg
attgaggcggggaactcagttatatcccttgataatctctacacaggtcgtaaagtcaat
aatgcccattggctagaacaccctaactttaaattcattgagcatgacgttatcaatccc
attgatattgagcaggtcgatcagatctatcatcttgcttgtccagcttcacctgtacat
taccaagctgatcccattaaaactgcccaaaccaactttttgggaaccttcaatgttttg
gaattagctaagcgatgcaaagcaagagttctccttgcctcaacatcagaagtgtacggc
gatcctttaattcatccgcaaaccgaagactattggggcaacgttaattgcacaggtatt
cgcagttgttatgacgaaggaaagcgaatttctgaaactctgacctttgattaccatcgt
caatttggtgttgaagtcagagttgctcgtattttcaatacccacggagtcagaatgcta
gagaatgatggacgggtagttagcaattttattgtgcaagcccttaagggaattccgctt
acgatctatggagatggctcccagacccgtagtttctgttatgtatccgatcttgttgaa
gggttaatccgtctcactaatggcaactacattggacctgtgaatctgggtaatccgggg
gaatataccattctacaattggcgcagacaattcaacgactaatcgatcccacggctgaa
ctggtatttaaacctttacctcaagatgatccccaacgtcgtcagcctgacatttcacgt
gctaagttccatttaggatgggaaccaaccgttccattggaagaaggcttagcgaaaaca
atcgcctattttcgcgatcacttatcggttaaatag

DBGET integrated database retrieval system