KEGG   Pseudomonas sp. StFLB209: PSCI_0375Help
Entry
PSCI_0375         CDS       T03623                                 

Definition
(GenBank) alpha-ribazole-5''''-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00860  Porphyrin and chlorophyll metabolism
pses01100  Metabolic pathways
Module
pses_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSCI_0375
Enzymes [BR:pses01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     PSCI_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PRP4
Motif
Other DBs
NCBI-ProteinID: BAP41077
UniProt: A0A077LAY2
Position
complement(422212..422790)
Genome map
AA seq 192 aa AA seqDB search
MIVDLLRHGETELGGGLRGSIDDALTEAGWAQMHAAVADAATGAASWTRIVSSPLQRCAR
FAQVLAERLQLPLSLDADVQELHFGDWEGRSAAQIMQTDADGLGAFWNNPYTFTPPNGEP
VAVFAERVGAALQRLQQRHSGERVLLVCHGGVIRLLLARARGLPREQLLQVSVAHGALHS
VQVAVDGTLTEL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgacctgctgcgccatggcgaaaccgagctgggcggcggtctgcgcggcagt
atcgacgatgccctgaccgaagcgggctgggcacagatgcatgccgccgtggccgacgct
gcaacaggtgccgcgtcatggacccggatcgtcagttcgccgttgcagcgctgtgcacgg
ttcgcgcaagtattggccgagcgtctgcaactgccgctgagcctggacgctgatgttcag
gagctgcatttcggtgactgggaagggcgcagcgcggcgcagatcatgcaaaccgatgcc
gatggcctgggcgcgttctggaacaacccctacaccttcaccccgcccaatggcgagccg
gtggcggtgtttgccgagcgtgtgggcgcggcgttgcaacgcttgcaacagcgccatagt
ggcgagcgggtattgctggtctgtcatggcggggtgatccgcctgttgttggcccgtgcc
cgcggcctgccccgtgagcagttgctgcaagtgtcggtggcccatggcgcgctgcacagc
gtgcaagtggcggtggatggcaccctgacggagctttga

DBGET integrated database retrieval system