KEGG   Pseudomonas sp. StFLB209: PSCI_1411Help
Entry
PSCI_1411         CDS       T03623                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00361  Chlorocyclohexane and chlorobenzene degradation
pses00625  Chloroalkane and chloroalkene degradation
pses01100  Metabolic pathways
pses01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSCI_1411
   00361 Chlorocyclohexane and chlorobenzene degradation
    PSCI_1411
Enzymes [BR:pses01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PSCI_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: BAP42113
UniProt: A0A077LGP1
Position
complement(1545985..1546653)
Genome map
AA seq 222 aa AA seqDB search
MSVLRPRFVTFDCYGTLTHFQMSPMTRQMFADRVPVERMDAFIKDFAAYRLDQVKGEWVP
YDQIIKQALARTCKRWGIDYRGEGQALYDAIPEWGPHPDVPAGLAKIASEIPLVIFSNAS
DSQIMSNVGKLGAPFHKVFTAEQAQAYKPRLAAFEFMLDNLGCGPQDVLHVSSSFRYDLF
PAHDMNITHKVFVARGHEQPANSIYGYRQISDISELPGLLGL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttctacgcccaagattcgtcaccttcgactgctacggcacgctgacgcacttt
cagatgagccccatgacccggcagatgttcgctgaccgggtgcctgtcgagcgtatggac
gccttcatcaaggacttcgcggcctaccgcctcgatcaggtcaaaggtgagtgggtgcct
tatgatcagatcatcaagcaagccctggcccgtacctgcaagcgctggggtatcgactac
cggggtgaaggccaggcactttacgatgcgatacccgagtgggggccgcatcctgatgtg
cctgccgggctggcgaaaatcgcgagcgaaattccgttggtgatcttctctaacgccagc
gacagtcagatcatgtccaacgtcggcaaactcggtgcgccgtttcacaaggtcttcacc
gccgagcaggcgcaggcttacaagccgcggttggcagcgttcgagttcatgctggataac
ctgggctgtggcccgcaggacgtgctgcatgtgtcatcgagctttcgctacgacctgttt
cctgcccacgacatgaacatcacccataaggtatttgtcgcgcgcgggcacgaacagccg
gccaacagcatctatggctaccgacagatcagcgatatcagtgagctgccggggttgctg
gggctttaa

KEGG   Pseudomonas sp. StFLB209: PSCI_4430Help
Entry
PSCI_4430         CDS       T03623                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00361  Chlorocyclohexane and chlorobenzene degradation
pses00625  Chloroalkane and chloroalkene degradation
pses01100  Metabolic pathways
pses01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSCI_4430
   00361 Chlorocyclohexane and chlorobenzene degradation
    PSCI_4430
Enzymes [BR:pses01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PSCI_4430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-ProteinID: BAP45132
UniProt: A0A077LME5
Position
complement(4961626..4962348)
Genome map
AA seq 240 aa AA seqDB search
MSKLDDVGFLGFDVFGTVVDWRSGVARAAEPFLRRHQIDIDPLEFADQWRSLYQPSMDRV
RSGERLFVTLDVLNRENLETVLSKYSVDYGRIAEAELAQLNKAWEQLDPWPDSVAGLGRL
KRKYSIGPLSNGHIAGMLNLSKFAQLPWDVIVGAEVAQSYKPQPQTYLKSAQTVGLPPER
VGMVAAHNSDLAAARVSGLKTIFVRRPTEHGPDQASDLTAEQDWDVVAESMTEAADALGC
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctagacgatgtaggttttcttggattcgatgtcttcggcacggttgtggac
tggcgctcaggtgttgccagagcagctgagcctttccttcgccgccatcaaatagacatc
gacccattggagttcgctgatcaatggcgctccctttaccaaccttcgatggatcgtgtc
aggagcggcgaacgtctctttgtaactctggacgttctcaacagggagaatctggaaacc
gttctctcaaagtatagcgtcgattacggcaggattgccgaagcggagctagcccagctg
aacaaagcatgggagcagctcgatccgtggcctgactcggtagccggcctgggccggctc
aaacgcaagtactcaatagggccgctttccaatgggcatattgccggaatgctcaacttg
tccaagttcgctcagttaccttgggacgtcatcgtgggtgcggaggtcgctcagtcgtac
aagccacagccccagacctatcttaaatcggcgcagacagtgggtctcccaccagagcgg
gtagggatggttgcagctcacaactcggatctagctgccgctcgcgtcagtggattgaaa
accatattcgtgcgccgcccgaccgaacacggccctgatcaagcgtcggatttaacggcc
gagcaagactgggacgtcgtagctgaatccatgaccgaagccgcagacgcgctgggctgc
tga

DBGET integrated database retrieval system