KEGG   Pseudomonas sp. StFLB209: PSCI_1560Help
Entry
PSCI_1560         CDS       T03623                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00071  Fatty acid degradation
pses00072  Synthesis and degradation of ketone bodies
pses00280  Valine, leucine and isoleucine degradation
pses00310  Lysine degradation
pses00362  Benzoate degradation
pses00380  Tryptophan metabolism
pses00620  Pyruvate metabolism
pses00630  Glyoxylate and dicarboxylate metabolism
pses00640  Propanoate metabolism
pses00650  Butanoate metabolism
pses00900  Terpenoid backbone biosynthesis
pses01100  Metabolic pathways
pses01110  Biosynthesis of secondary metabolites
pses01120  Microbial metabolism in diverse environments
pses01130  Biosynthesis of antibiotics
pses01200  Carbon metabolism
pses01212  Fatty acid metabolism
pses02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSCI_1560
   00630 Glyoxylate and dicarboxylate metabolism
    PSCI_1560
   00640 Propanoate metabolism
    PSCI_1560
   00650 Butanoate metabolism
    PSCI_1560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSCI_1560
   00072 Synthesis and degradation of ketone bodies
    PSCI_1560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSCI_1560
   00310 Lysine degradation
    PSCI_1560
   00380 Tryptophan metabolism
    PSCI_1560
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSCI_1560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSCI_1560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSCI_1560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pses04147]
    PSCI_1560
Enzymes [BR:pses01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSCI_1560
Exosome [BR:pses04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSCI_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAP42262
UniProt: A0A077LDZ5
Position
complement(1700879..1702120)
Genome map
AA seq 413 aa AA seqDB search
MNRAGQYSAFSDVAIFAALRTPWADLGGALAQVSPIDLGIKVGRGVLAQAGLQAADVDSV
LAGSMAQASFDAYLLPRHIGLYSGVPQQVPALAVQRICATGFELLRQAAIQVGEGAQLAL
CVAAESMSRNPIAAYTHRDGFRLGGEVGFKDFLWEALHDPAPGIDMIATADRLAVRYELA
REAVDSYALQSHQLTLQAQASGWLAEEILPVSNECFELAGYQPRGIRLPRGVESVSQDSH
PRSTELAALARLRAVHEGGVQTAGNSCAVVDGAAAALVGPASAARRPALAWLRASAVVGV
APEYMGIGPAPAIRLLLQRSGLQLHDIGLLEINEAQAAQVLAVARELELDGERLNRRGGA
IGLGHPLAASGLRLVLSLARQLRDNNLRYGIAAACVGGGQGMAVLIENPDWQH
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgccggccagtactcggcgttttccgacgtggcgattttcgctgccttgcgc
accccctgggcagacctgggcggtgcgctggctcaagtgtcaccgatcgatctggggatc
aaggtcggtcgcggtgtactggcgcaggccggcttgcaggcagccgatgtcgacagcgtg
ctggccggctccatggcccaggccagctttgatgcctacctgctgccccggcatatcggc
ctgtacagcggcgtgccgcagcaggttccggcactggcggtgcagcggatctgtgccacc
ggtttcgaactgctgcgccaggcggccatacaagtgggcgaaggcgcgcaactggcgctg
tgcgtggcggccgaatcgatgtcgcgcaacccgattgccgcctacacccatcgcgacggc
tttcgtctgggcggcgaagtggggttcaaggactttctctgggaggcgttgcacgatccg
gcaccgggcatcgatatgatcgccaccgctgatcgtctcgctgtgcgctatgagctggcg
cgcgaggcggtagacagctacgccttgcaaagtcaccaactgacgctgcaagcacaggcc
agcggctggctggcggaagaaattctgccggtcagcaacgaatgcttcgagctggccggc
tatcagccacgcggcatccgcttgccgcgcggagtcgagagcgtcagccaggacagccac
ccgcgcagcaccgaactggccgccctggcacggctgcgggcggtgcatgagggcggggtg
cagaccgctggcaatagctgcgcggtggtcgatggcgcggcggctgcattggttggccct
gcatcggctgcccgccgcccagcattggcctggctgcgcgccagtgcggtggtcggcgta
gcccctgaatacatgggcatcggtcctgcgccggcgatccgcctgctgttgcagcgcagc
ggcctgcaactgcatgacatcggcttgctggaaatcaacgaagcccaggccgcccaggta
ctggccgtggcccgtgagctggaactggacggcgaacggctcaaccgccggggtggcgcc
atcggcctcggccatccgttagccgccagcggcttgcgcctggtgctgagcctggcccgg
caactgcgcgacaacaacctgcgctatggcattgccgcggcctgtgtcggcggcgggcag
ggcatggcggtgctgatcgaaaacccggattggcaacactga

DBGET integrated database retrieval system