KEGG   Pseudomonas sp. StFLB209: PSCI_2052Help
Entry
PSCI_2052         CDS       T03623                                 

Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00040  Pentose and glucuronate interconversions
pses00053  Ascorbate and aldarate metabolism
pses01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSCI_2052
   00053 Ascorbate and aldarate metabolism
    PSCI_2052
Enzymes [BR:pses01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     PSCI_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAP42754
UniProt: A0A077LLP7
Position
2251007..2252587
Genome map
AA seq 526 aa AA seqDB search
MTSITGWNYIGGQRSAEGQTTLQSFDASTGQALPYAFHQATEAEVDAAARAAQDAYPAFR
SLPAARRAEFLEAIADELDALGEHFVALVCQETALPAARIQAERGRTSGQMRLFAKVLRR
GDFYGARIDRALPERQPLPRPDLRQWRIGLGPVAVFGASNFPLAFSTAGGDTAAALAAGC
PVVFKAHSGHMGTAELVADAILRAARRTDMPTGVFNMIFGGGVGAWLVQHPAIQAVGFTG
SLAGGRALCDIAAARPQPIPVFAEMSSINPVLLLPEALQVRGERIASELSAAVVLGAGQF
CTNPGLVIGIRSAAFDAWLQHFVRLMGDQPAQTLLNTATLKSYCHGLERLHAHPAVSHLA
GAAQQGQQAHAQVFKADVALLIDGDELLQEEVFGPTTVVVEVADQAELLRALHGLRGQLT
ATLIAEPGDLRNHTELTGLLEHKAGRLLINGYPTGVEVCDAMVHGGPYPATSDARGSSVG
SLAIDRFLRPVCYQNYPDEWLPDALKNANPLGIERLVDGLHSREVL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatcacgggttggaactacatcggcggtcagcgcagcgcggaaggccagacc
accttgcaaagctttgacgccagcaccgggcaggccctgccttatgcctttcatcaggcc
accgaggccgaggtcgatgctgcggcgcgggcggcgcaggacgcctatccggcgtttcgc
agtttgccggccgcacggcgggcagagtttcttgaggcgatcgccgatgagctcgatgcc
ctaggtgagcatttcgtcgcgctggtgtgtcaggagacggcattgccagcggcacgcatc
caggcagagcggggccgaaccagcgggcagatgcggctgtttgccaaggtgttgcgccgg
ggtgacttttacggcgcgcgtattgatcgtgccttgcctgaacgccagcctctgccgcgg
ccggacctgcgccagtggcggatcggtctgggaccggtggcggtgtttggggccagcaat
tttccgctggccttctccacggccggtggcgataccgcagcggcattggccgctggctgc
ccggtggtattcaaggcccacagcgggcacatgggcaccgcagaactggtggctgatgcg
atcttgcgggctgcgcgccgcactgacatgccgaccggtgtgttcaatatgatcttcggc
ggtggcgtgggggcctggctggtgcagcatccggccatccaggcggtcggctttaccggc
tcgctggccggtggccgggccttgtgcgacatcgccgccgcgcgcccccagccgattccg
gtcttcgcagagatgtcgagtatcaatccggtgctgctgttgcctgaagccctgcaggtg
cggggtgagcgcatcgcctcggagttgagcgcagcggtggtcttgggcgccgggcagttc
tgtaccaatcccggtctggtgatcggcatacgttcggcggccttcgatgcctggctgcag
cactttgtccgattgatgggtgatcagccggcacagaccctgctcaataccgcaaccctc
aagagctactgtcatggccttgagcggctgcatgcgcatccagctgtcagccatctggcc
ggtgccgcgcagcagggccagcaggcccacgcccaagtgttcaaggccgacgtcgcgctg
ttgatcgatggcgatgaactgctgcaggaagaggtgtttggcccgaccacggtggtggtc
gaagtcgccgaccaggccgaactgctgcgtgccttgcacggcttgcgcggccaactgacc
gcgaccctgatcgccgagccgggtgatctgcgcaaccacaccgaactcaccggcctgctg
gagcacaaagccgggcggctgctgattaatggctatccgaccggggtcgaggtgtgtgac
gccatggtgcatggcggtccgtacccggccacctccgacgcgcgtggcagctcggtgggc
agcctggccatcgatcgcttcctgcgtccggtgtgctaccagaactaccctgacgaatgg
ctgcccgatgcgctcaaaaatgccaacccgctgggtatcgagcggctggtagatgggctg
cacagccgcgaggtgctgtag

DBGET integrated database retrieval system