KEGG   Pseudomonas sp. StFLB209: PSCI_3358Help
Entry
PSCI_3358         CDS       T03623                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00010  Glycolysis / Gluconeogenesis
pses00053  Ascorbate and aldarate metabolism
pses00071  Fatty acid degradation
pses00280  Valine, leucine and isoleucine degradation
pses00310  Lysine degradation
pses00330  Arginine and proline metabolism
pses00340  Histidine metabolism
pses00380  Tryptophan metabolism
pses00410  beta-Alanine metabolism
pses00561  Glycerolipid metabolism
pses00620  Pyruvate metabolism
pses00625  Chloroalkane and chloroalkene degradation
pses00903  Limonene and pinene degradation
pses01100  Metabolic pathways
pses01110  Biosynthesis of secondary metabolites
pses01120  Microbial metabolism in diverse environments
pses01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSCI_3358
   00053 Ascorbate and aldarate metabolism
    PSCI_3358
   00620 Pyruvate metabolism
    PSCI_3358
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSCI_3358
   00561 Glycerolipid metabolism
    PSCI_3358
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSCI_3358
   00310 Lysine degradation
    PSCI_3358
   00330 Arginine and proline metabolism
    PSCI_3358
   00340 Histidine metabolism
    PSCI_3358
   00380 Tryptophan metabolism
    PSCI_3358
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSCI_3358
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSCI_3358
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSCI_3358
Enzymes [BR:pses01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PSCI_3358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAP44060
UniProt: A0A077LHM9
Position
3776786..3778279
Genome map
AA seq 497 aa AA seqDB search
MVAKLLESLGVDKSAYTGGNHAVYTPIDGSQIGAVTLESKEQVAARVQSAHQAFLKWRSV
PAPRRGELVRIFGEVLREHKAELGELVSIEAGKITQEGLGEVQEMIDICDFAVGLSRQLY
GLTIASERPGHHMRETWHPLGVVGVISAFNFPVAVWAWNTALALVAGNAVLWKPSEKTPL
TALASQALFDKALKIFGSDAPEGLAQLIIGDREAGEVLVDDPRVPLVSATGSTRMGREVG
PRVAARFGRSILELGGNNAMILAPSADLDLAVRGILFSAVGTAGQRCTTLRRLIVHRSIK
DEVVARVKAAYGKVRIGDPREGNLIGPLIDKQAFTAMQDALTKARDEGGQVFGGERQLAE
QFPNGYYVTPAIAEMPGQSDVVRHETFAPILYVLAYDEFEEALRLNNEVPQGLSSCIFTT
DIREAEAFQSAAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKGYMRRQTN
TVNYSRELPLAQGIVFD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtggttgccaaactgttggaaagcctgggcgtagacaagagtgcttatacgggcggcaac
catgccgtctacacccccatcgatggcagccagatcggtgccgtcaccctggagagcaag
gaacaggtcgctgcccgtgtgcagagcgcccatcaagccttcctcaaatggcgcagcgtt
ccggccccgcgccgtggcgagctggtgcgtatttttggtgaagtgctgcgtgagcacaaa
gccgagctgggcgagctggtctcgatcgaggctggcaagatcactcaggaaggtctgggt
gaagtgcaggaaatgatcgacatctgcgacttcgccgttggcctgtcgcgtcaactgtac
ggtctgaccatcgcctccgagcgccctggtcaccacatgcgtgaaacctggcacccgctg
ggtgtggtgggggtgatcagcgcctttaacttcccggtcgcggtctgggcctggaacacc
gccctggcgctggtagccggtaacgccgtgctgtggaaaccgtccgagaaaaccccgttg
accgccctggcttcccaggcgctgttcgacaaagccctgaaaatcttcggcagcgatgcc
cctgaaggcctggcgcagttgatcattggtgaccgtgaggccggcgaggtactggtcgat
gacccgcgcgtaccactggtcagcgccaccggcagcacccgcatgggccgtgaagtcggc
ccgcgtgtcgcggcacgttttgggcgcagcattcttgagctgggtggcaacaacgcgatg
atcctggcgccgagtgccgacctggacctggccgtgcgcggcatcctgttcagcgccgtc
ggcaccgccggccagcgttgcaccacgctgcgccgcctgatcgtgcatcgctcgatcaag
gacgaggtggtggctcgggtcaaagctgcgtacggcaaagtccggatcggtgacccgcgt
gaaggcaacctgatcggcccgctgatcgacaaacaggcttttaccgccatgcaggacgcg
ctgaccaaggctcgcgacgaaggcggccaggtgttcggcggcgagcggcaactggccgag
caatttccgaacggctactacgtcactccggccatcgctgaaatgcctgggcaaagcgat
gtggtgcgtcacgagaccttcgcaccgatcctttacgtgctggcctatgacgagtttgaa
gaagcgctgcgcctgaacaacgaggtgccgcaaggcctgtcgtcgtgcatcttcaccacc
gacattcgcgaagccgaagccttccagagcgcggccggcagcgactgcggcattgccaac
gtcaacatcggcaccagcggtgcagaaatcggcggcgcgttcggtggcgagaaagaaacc
ggtggcggccgcgagtccggctccgatgcctggaaaggctacatgcgccgccagaccaac
acggtcaactactcccgcgaactgccgctggcccaaggcatcgtgtttgattga

DBGET integrated database retrieval system