KEGG   Pseudomonas sp. StFLB209: PSCI_4548Help
Entry
PSCI_4548         CDS       T03623                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
pses  Pseudomonas sp. StFLB209
Brite
KEGG Orthology (KO) [BR:pses00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSCI_4548
Enzymes [BR:pses01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     PSCI_4548
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     PSCI_4548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA DUF3151
Motif
Other DBs
NCBI-ProteinID: BAP45250
UniProt: A0A077LL10
Position
5091905..5092927
Genome map
AA seq 340 aa AA seqDB search
MSERPVIGITMGDAAGVGPEIIMKSLQHDSVYAMCRPLVIGDAKRLVDANRIVAGTLQVN
AIEQPEQARFQPGVVDCIDLGLIPHDLPYGQLSAVAGDAAFRYIERTVQLTEAGALDAIC
TAPLNKEALHAGGHIFPGHTEMLAHLTGIEEVSMMLMTPTLRVIHVTTHIGIIDAIARIE
PGLVRRTIERAHETLSRAGIDNPLIAVCGINPHAGENGLFGYGEEATKIQPAIDELRARG
WRVEGPLPADTLFFRAGRGDFDAVVAMYHDQGHGPVKVMGLEAGVNVTVGLPVIRTSVDH
GTAFDIAGKGIADERSLIEALRQAVELATRKRTLEQPAHA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcgtcctgtgatcggcatcaccatgggtgatgcggccggcgtcggtccggaa
atcatcatgaaatccctgcaacacgacagcgtctatgccatgtgccggccgctggtgatt
ggcgatgccaagcggctggtcgatgccaatcggatcgtcgctggcacgctgcaagtcaac
gccatcgaacagcccgagcaggcccgctttcagccaggcgtggtggattgtatcgatctg
gggctgatcccccatgacctgccctacggccagttgtcggcggtggccggtgatgcggcc
tttcgttatatcgagcgcaccgtgcaactgaccgaggccggtgccctggacgcgatatgc
accgcgccactgaacaaggaagcactgcacgccggcgggcatatcttccccggccacacc
gaaatgctcgcgcacctgaccggcatcgaagaggtgtcgatgatgctcatgaccccgacg
ctgcgggtcattcatgtcacgacccacatcggcatcatcgacgccattgcgcgcatcgag
ccaggtctggtgcgccgcaccatcgaacgtgcccatgaaaccctgagccgcgccgggatc
gacaacccgttgatcgcggtgtgcggcatcaacccgcatgccggtgaaaacggcctgttc
ggctacggcgaagaggcgaccaagatccagccggcgattgacgagctgcgcgcccgtggc
tggcgcgtcgaaggcccgctgccggccgacacgctgtttttccgcgccgggcgcggcgac
ttcgatgcggtggtggccatgtatcacgaccagggccacggcccggtcaaggtcatgggg
ctggaagccggggtcaacgtcacggtcggcctgccggtgatccgcacatccgtggaccac
ggcaccgctttcgatatcgccggcaagggcatcgccgacgagcgcagcctgatcgaggca
ctgcgtcaggcggtcgagctggcgacccgcaaacgcaccctggagcaacccgcgcacgcc
tga

DBGET integrated database retrieval system