KEGG   Pseudomonas sp. StFLB209: PSCI_4970Help
Entry
PSCI_4970         CDS       T03623                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00010  Glycolysis / Gluconeogenesis
pses00071  Fatty acid degradation
pses00350  Tyrosine metabolism
pses00625  Chloroalkane and chloroalkene degradation
pses00626  Naphthalene degradation
pses01100  Metabolic pathways
pses01110  Biosynthesis of secondary metabolites
pses01120  Microbial metabolism in diverse environments
pses01130  Biosynthesis of antibiotics
pses01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSCI_4970 (adh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSCI_4970 (adh)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PSCI_4970 (adh)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSCI_4970 (adh)
   00626 Naphthalene degradation
    PSCI_4970 (adh)
Enzymes [BR:pses01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSCI_4970 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C ELFV_dehydrog UDPG_MGDP_dh_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: BAP45672
UniProt: A0A077LNQ7
Position
complement(5604407..5605447)
Genome map
AA seq 346 aa AA seqDB search
MKAVVYEAFNAAPRLMTVDDPTPEAHGVVVQVLGTGVCRSDWHGWKGHDPDIQLPHIPGH
ELAGVIAAVGRHVTRWKVGDRVTVPFVGGCGACPECNSGNQQVCYSQFQPGFTHWGSFAE
YVGIHQADLNLVALPESMDFATAASLGCRFVTSFRAVVDQGKVSAGQWVAVHGCGGVGLS
AVMIAHAIGANVIAIDIADHKLALARSLGAVATVNARQVANVTEAVQEISGGGVHVSLDA
LGHPTTCFNSINNLRRRGKHVQVGLMLADHSTPAIPMSNVIAHELEIYGSHGMQAHRYGA
ILDMINSGKLAPEKLVGKTISLEQSIDALVNMDRFETAGVTVVTQF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgtctatgaagcctttaacgccgccccgcggctgatgacggtcgatgac
ccgacgcctgaggcgcacggtgtcgtggtgcaagtgctcggcacgggggtatgccgcagc
gactggcacggctggaagggccacgacccggatatccagttgccgcacatccccggccac
gagctggccggtgtcatcgcggcagtgggccggcacgtgacccgctggaaagtcggtgat
cgcgtcactgtgccgttcgtgggcggctgcggcgcgtgcccggagtgcaacagcggcaac
cagcaagtgtgttacagccagttccagccgggcttcacccactgggggtcgtttgccgaa
tatgtcggcattcatcaggccgacctgaacctggtggcgctgccagagagcatggatttc
gccaccgcagccagccttggctgccggttcgtcacttcgtttcgcgcggtggtcgatcag
ggcaaggtcagcgccgggcaatgggtcgcggtgcatggctgtggtggggtggggctgtcg
gcggtgatgattgcccacgccattggtgccaacgtgattgccatcgatattgccgaccac
aaactggccctggcgcgttcgctgggggcggtggccacggtcaatgcccggcaggtggcc
aacgtcaccgaagcggtgcaggaaatcagtggcggcggtgtgcatgtgtcactcgacgcg
ctcggccacccaaccacctgtttcaactccatcaacaacctgcgccgccgcggcaagcac
gtgcaggtcgggctgatgctcgccgatcacagcacgccggctatcccgatgagcaatgtg
atcgcccatgagctggaaatctatggcagccacggcatgcaggcgcaccgctacggcgcg
attctcgacatgatcaactccggcaaactggcccccgaaaaactggtgggcaagaccatc
agcctggagcagtcgattgatgcgctggtcaatatggaccgctttgaaactgccggggtg
acggtggtgacgcagttctga

DBGET integrated database retrieval system