KEGG   Pseudomonas sp. StFLB209: PSCI_5224Help
Entry
PSCI_5224         CDS       T03623                                 

Definition
(GenBank) TenA/Thi-4 family protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00730  Thiamine metabolism
pses01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PSCI_5224
Enzymes [BR:pses01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     PSCI_5224
Transcription factors [BR:pses03000]
 Prokaryotic type
  Other transcription factors
   Others
    PSCI_5224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: BAP45926
UniProt: A0A077LNP7
Position
complement(5898669..5899334)
Genome map
AA seq 221 aa AA seqDB search
MDIFARLKTAACTEWRSYVEHAFVQQLGAGTLPQAAFRQYLIQDYLFLIQFARAWALAAY
KSRSIDDIRAAQAGLAAILNETELHVRLCDRWGISRQVMDAAPEHQATVAYTRYVLDCGA
AGDLLELHVALAPCVIGYAEIGRALAPQGVDALGEHPYVDWIGEYASQGYQQVAADARRH
LDQLAARSMTEQRFAQLTGIFATASRLEADFWQMGLEVLKH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggatatcttcgcccgcctgaaaaccgcggcttgcaccgaatggcgcagctacgtggaa
cacgccttcgtccagcaactgggcgccggcaccttgccccaggctgcctttcgccagtac
ctgattcaggattacctgttcctgatccagttcgcccgcgcctgggcgctggccgcttat
aaaagccgcagcatcgacgacattcgtgcggcccaggccgggctggcggcgattctcaac
gagaccgagctgcacgtgcgcctgtgcgaccgctggggcatcagccgccaggttatggac
gccgcccccgagcatcaggcgaccgtggcctatacccgttacgtactcgactgcggcgcc
gccggtgacttgctggaactgcacgtcgccctggcgccgtgcgtgattggctacgcagaa
atcggccgcgccctggcgcctcagggtgtcgacgcgttgggcgagcatccgtatgtcgac
tggatcggtgaatacgccagccagggttatcagcaggtcgcggctgatgcccgccgtcac
ctcgatcaattggcggcgcggagcatgaccgagcagcgttttgctcaattgaccggcatc
tttgccaccgcctcgcggctggaagcggacttctggcaaatggggctggaggtactgaaa
cactga

DBGET integrated database retrieval system