KEGG   Pseudomonas sp. TCU-HL1: THL1_1125Help
Entry
THL1_1125         CDS       T05373                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamatesynthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00471  D-Glutamine and D-glutamate metabolism
pset00550  Peptidoglycan biosynthesis
pset01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    THL1_1125
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THL1_1125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pset01011]
    THL1_1125
Enzymes [BR:pset01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     THL1_1125
Peptidoglycan biosynthesis and degradation proteins [BR:pset01011]
 Precursor biosynthesis
  Amino acid ligase
   THL1_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AOE83673
UniProt: A0A1B3E2A5
Position
1213509..1214855
Genome map
AA seq 448 aa AA seqDB search
MTLIASDQFRIVVGLGKSGMSLVRFLALQGVPFAVADTRANPPELASLQSQYPQVEVRCG
ELDPDFLSRASELYVSPGLALATPALQEAARRGVKLSGDIELFTRHAKAPIVAITGSNAK
STVTTLVGDMARAAGKRVAVGGNIGTPALDLLADDIELYVLELSSFQLETTDRLNAEVAT
VLNVSEDHMDRYADMQAYHLAKHRIFRGARQVVVNRGDALSRPLVADQLPCWPFGLNKPD
FKSFGLIEEGGEKYLAYQFDTLMPVRDLKIRGAHNQANALAALALGHAVGLPLEPMLDTL
RTFAGLDHRCQWVRELRGVSYYNDSKATNVGAALAAIEGLGADIEGKLVLIAGGDGKGAD
FSGLKVPVVRFCRAVVLLGRDAELIAGVLGDDVPLVRVNTLDEAVQRCAELAEPGDAVLL
SPACASLDMFKNFEERGRLFAQAAEGLA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttgatcgcttccgaccagttccgcatcgttgtcggcctcggcaagagcggcatg
tccctggtgcgcttcctggcgcttcagggcgttccgtttgccgtggctgatacccgcgcg
aacccgccggagctggcgtcgcttcagagccagtacccgcaggttgaagtacgctgcggt
gaactggatccggacttcctcagtcgcgcgagcgagctttacgtgagcccgggcctggcc
ctggcgactcccgccttgcaggaagcagcgcggcgtggtgtgaagctgtccggggatatc
gaactcttcacccgccatgccaaggccccgatcgtggccattaccggctccaacgccaag
agcaccgtcaccaccctggttggtgacatggccagggcggccggcaagcgagttgccgtg
ggtggaaacatcggtacgccggcgctcgatctgctggccgacgatatcgagctctacgtg
cttgaactctccagcttccagctggagaccactgatcggctgaacgctgaagtagccacc
gtgctcaatgtcagcgaagaccacatggaccgctatgccgacatgcaggcctatcacctc
gccaagcaccgcattttccgcggcgcgcgtcaggtggtggtcaatcgtggcgatgccctg
tcgcgtcctttggtggctgaccagctgccgtgctggcccttcggcctgaacaagccggat
ttcaagtccttcggtctgatcgaagagggcggcgagaagtacctcgcgtaccagttcgac
acgctgatgccggtgcgcgacctgaagatccggggcgcgcacaaccaggccaatgccctg
gcggcgcttgccctggggcatgcggttgggctgccactcgaacccatgctggacaccctg
cggacctttgccggcctggaccatcgttgccagtgggtgcgcgagttgcgaggcgtgtcc
tactacaacgattccaaggccaccaacgttggcgcggccctggcagccatcgaaggcttg
ggtgccgatatcgaaggcaagttggtgctgatcgccggtggcgacggcaagggcgctgat
ttctccggcctcaaggttccggtagttcgcttctgccgcgccgttgtgctgctcggtcgc
gatgccgagctgatcgccggtgtcctgggcgatgacgtgccgctggtgcgggtcaatacc
ctggacgaagcggttcagcgttgcgccgaactggctgaaccaggagatgccgtgctgctg
tcgccagcctgcgccagcctggatatgttcaagaacttcgaagaacgcgggcgtcttttc
gcccaggctgcggaggggctcgcctga

DBGET integrated database retrieval system