KEGG   Pseudomonas sp. TCU-HL1: THL1_1821Help
Entry
THL1_1821         CDS       T05373                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00860  Porphyrin and chlorophyll metabolism
pset01100  Metabolic pathways
Module
pset_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THL1_1821
Enzymes [BR:pset01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     THL1_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: AOE84369
UniProt: A0A1B3E4A5
Position
1942024..1943499
Genome map
AA seq 491 aa AA seqDB search
MTTLMVQGTTSDAGKSTLVTALCRWLARQGVAVAPFKPQNMALNSAVTADGGEIGRAQAV
QAQACGLAPHTDMNPVLLKPNTDIGAQVIIHGRAVTSMNAAAYHDYKKVAMAAVLESHQR
LSARYPVVMVEGAGSPAEINLRANDIANMGFAEVVDCPVILVADIDRGGVFAHLVGTLEL
LSPSEQARVKGFVINRFRGDIALLKPGLDWLEQRTGKPVLGVLPYLTDFHLEAEDAIDQR
QAFKGGELLQVAVPVLPRISNHTDFDPLRLHPQVQLNFVGPGQPIPPADLIILPGSKSVR
ADLARLREHGWDKALQRHLRYGGKVLGICGGYQMLGCSIADPHGLEGPAGASDGLGLLDI
DTVLEPEKQLRNVGGRLLLESATVSGYEIHAGVTTGAGLEHPAVALDDGRVDGARSLDGQ
VMGTYLHGFFESSDACAAILRWAGLAAVQTVDYHALRERDIERLADQVEQHLDTRWLADL
CGLGNQEHRHA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctgatggtgcagggcaccacctccgacgccggcaagagcaccctggtgacc
gccctgtgccgctggcttgcgcgccagggtgttgcggtggcgccgttcaaaccgcagaac
atggcgctgaacagcgcggtgaccgccgatggtggcgagatcggccgtgcccaggcggta
caggcgcaagcctgcggactggcgccccataccgacatgaacccggtgctgctcaagccg
aacaccgacatcggtgcccaggtgatcatccacggtcgcgccgttaccagcatgaatgcg
gcggcctaccacgactacaagaaagtcgcgatggcggccgtgctggagtcccatcagcgc
ctgtcggcccggtatccggtggtgatggtggagggcgccggctcaccggcggagatcaac
ctgcgcgccaacgacatcgccaacatgggtttcgccgaagtggtggattgcccggtgatc
ctggtggccgatatcgaccggggcggcgttttcgcccatctggtgggcaccctggagttg
ctgtcgcccagcgagcaggcgcgggtgaagggcttcgtcatcaaccgtttccgcggcgat
atcgccctgctcaaaccgggactcgactggctggaacaacgtaccggcaagcccgtgctt
ggcgtactgccctacctcactgacttccacctggaagccgaggacgccatcgaccagcgc
caggctttcaagggcggcgagttgctgcaggtggcggtgccggtgctgccgcgcatcagc
aaccacaccgacttcgaccccctgcgcctgcacccgcaggtacagctcaacttcgttggt
cccggccagcccattccgccggctgacctgatcatcctgcccggctccaagagcgtgcgc
gctgatctcgcgcggctgcgcgaacacggatgggataaggccttgcagcgtcatttgcgc
tatggcggcaaggtgctgggcatctgcggcggctatcagatgctcggctgcagcattgcc
gatcctcacggcctcgaaggcccggcgggggcgagcgacggcctcggcctgctggacatc
gacaccgtgctggagccggaaaaacagctgcgcaatgtcggcggccgcctgctgctggaa
agcgcgaccgtgagcggctacgaaatccatgccggcgtcaccacgggcgccggtctcgaa
caccccgccgtcgcgctggacgatggccgagtcgatggcgcccgcagcctggatggccag
gtcatgggcacctacctgcacggctttttcgaatcctccgatgcctgcgccgccatcctt
cgctgggcaggcctcgcggcggtgcaaacagtggattaccacgccttgcgcgaacgcgat
atcgaacgtctggccgaccaggtggagcaacacctggatacccgctggctggccgatctg
tgcggccttggcaaccaggagcatcgtcatgcgtga

DBGET integrated database retrieval system