KEGG   Pseudomonas sp. TCU-HL1: THL1_3794Help
Entry
THL1_3794         CDS       T05373                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pset  Pseudomonas sp. TCU-HL1
Brite
KEGG Orthology (KO) [BR:pset00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pset03009]
    THL1_3794
Enzymes [BR:pset01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     THL1_3794
Ribosome biogenesis [BR:pset03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    THL1_3794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AOE86342
UniProt: A0A1B3EA12
Position
complement(4038710..4039759)
Genome map
AA seq 349 aa AA seqDB search
MNTLLLHCRPGFEGEVCAEISELAARLDVAGYAKAKPNSACAEFICSEPGGTERLMRKQR
FGQLIFPRQWARGDYVELPETDRIGVLLDTLAGYPVCGSLWLEVLDTNDGKELSNFCRKF
EKPLRAALTKAGKLKDDAQLPRLLLTFRSGREAFVGLAESNNSALWPMGIPRLKFPREAP
SRSTLKLEEAWHHFIPRADWDKRLAPGMTAVDLGAAPGGWTWQLVQREIKVTAVDNGPMA
ESLMYSGFVEHQRADGFTFKPRRPVNWMVCDIVEKPARTAAMIETWLGEGWCQEAVVNLK
LPMKQRYAEVQKLLARIDAGLKGRGLKVSIACKQLYHDREEVTCHLRRL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccttgctgttgcactgccgccccggcttcgagggtgaagtctgtgccgagatt
tccgagcttgccgcccgcctcgacgtggccggttacgctaaggccaagccgaatagtgcc
tgtgccgagttcatttgcagtgaacccggcggcacggagcgactgatgcgcaaacagcgc
ttcggccaactgattttcccccgtcagtgggcccgtggcgattacgtcgaactgccggaa
accgaccgcatcggcgtactgctggacacgctggccggttacccggtgtgcggcagtctc
tggctggaggtgctggataccaacgacggcaaggaactgtcgaacttctgccgcaagttc
gagaagcccctgcgcgctgcgctgaccaaggccggaaagctcaaggacgatgcgcaactg
ccgcgcctgttgctgaccttccgcagtggccgcgaggcgttcgttggcctggccgaatcg
aacaactcggctctctggccgatgggcattccgcgtctgaagttcccccgcgaggcgccc
agtcgctccaccctcaagctggaggaggcctggcaccacttcattccccgagctgactgg
gacaagcgcctggcgccgggcatgacagctgtggacctgggcgccgccccgggcggctgg
acctggcaactggtgcagcgggagatcaaggtcaccgccgtcgataacggccccatggcg
gagagcctgatgtattccggcttcgtcgaacaccagcgcgccgacggctttacgttcaag
ccacggcgtccggtgaactggatggtctgcgatatcgtcgagaagcccgcgcgcactgcg
gcgatgatcgagacctggctgggcgagggctggtgccaggaagctgtggtcaacctcaaa
ctgccgatgaaacagcgctatgccgaggtgcagaagctgctggcgcgcatcgacgccgga
ctgaagggcagggggctgaaggtgtccattgcctgcaagcagctctatcacgaccgtgag
gaagtgacctgtcatctgcgcaggttgtga

DBGET integrated database retrieval system