KEGG   Pseudomonas sp. TCU-HL1: THL1_517Help
Entry
THL1_517          CDS       T05373                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
pset  Pseudomonas sp. TCU-HL1
Brite
KEGG Orthology (KO) [BR:pset00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    THL1_517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AOE83065
UniProt: A0A1B3E0M5
Position
complement(574997..575377)
Genome map
AA seq 126 aa AA seqDB search
MTDSRYQVDVSVATRFLPEQSQPDENRFAFAYTVTIQNNGELPAKLLTRHWVITDGDGHV
QEVRGAGVVGQQPLIAPGASHTYTSGTVMATQVGSMQGSYQMVADDGKRFDAIIAPFRLA
VPGSLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgattctcgctatcaggtcgacgtcagcgtcgccacccgcttcctcccggaacaa
tcccagccggacgagaaccgctttgccttcgcctataccgtgaccatccagaacaatggc
gagttgcctgccaaactgctcactcgccactgggtgatcaccgatggcgatggccatgtt
caggaagtccgcggtgccggcgtcgtcggtcagcagcccctgatcgcgccaggcgccagt
cacacgtacaccagcggcaccgtcatggccacgcaagtgggtagcatgcaaggcagctac
cagatggtcgccgatgacggcaagcgcttcgacgccatcatcgcgcccttccgtcttgcc
gttcccggctcgctgcattga

DBGET integrated database retrieval system