KEGG   Pseudomonas sp. TCU-HL1: THL1_5279Help
Entry
THL1_5279         CDS       T05373                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00010  Glycolysis / Gluconeogenesis
pset00020  Citrate cycle (TCA cycle)
pset00620  Pyruvate metabolism
pset01100  Metabolic pathways
pset01110  Biosynthesis of secondary metabolites
pset01120  Microbial metabolism in diverse environments
pset01130  Biosynthesis of antibiotics
pset01200  Carbon metabolism
Module
pset_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THL1_5279
   00020 Citrate cycle (TCA cycle)
    THL1_5279
   00620 Pyruvate metabolism
    THL1_5279
Enzymes [BR:pset01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     THL1_5279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: AOE87826
UniProt: A0A1B3EE38
Position
5717244..5719190
Genome map
AA seq 648 aa AA seqDB search
MSEMIRVPDIGSGEGEVIELFVKVGDRIEADQSLLTLESDKASMEIPAPKAGVIKSLKVK
LGDRLKEGDELLELEVEGTAAAAPAQAATPTPKAEEKPAAAPAAASSSVQDIFVPDIGSG
GTAKVIEVLVKAGDTVEAEQSLITLESDKASMEIPSPAAGVVESVEVKLDADVGTGDLIL
KLRVAGVAPAAAQTPVQAAAPTAAPAPAAAPAPAAAASVQDIKVPDIGSAGKAKVIEVLV
KAGDTVEADQSLITLESDKASMEIPSPAAGVVESVEVKLDAEVGTGDLILKLKVAGAAPA
AEQPVHRVPEGAHPVAAAEVTAIAALAAAAANTTGVPARSSGAKVHAGPAVRQLAREFGV
DLAVVPATGPHGRVLKEDVQTYVKAMMQKAKEAPAAAAGATGGAGIPPIPAVDFSKFGEI
EEVAMTRLMQVGAANLHRSWLNVPHVTQFDSADITELEAFRVAQKAVAEKAGVKLTVLPL
LLKACAYLLKELPDFNSSLAPSGKALIRKKYVHIGFAVDTPDGLLVPVIRDVDQKSLLQL
AAEAAALAEKARTKKLSADDMQGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKAAMQP
VWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDVLADIRTMLL
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaatgattcgcgtacccgacatcggcagcggcgaaggtgaagtaatcgagctg
ttcgtcaaagttggcgaccgcatcgaagccgatcagagcctgctgaccctggagtcggac
aaggccagcatggaaatccccgcgcccaaggccggtgtgatcaagagcctgaaggtcaag
ctgggtgatcgcctgaaggaaggcgatgaactgctggagttggaagtcgagggcaccgcc
gctgcggcgcctgcgcaggcagccactcccacccccaaggccgaagagaaacccgctgcc
gcccctgcggccgccagctccagcgtgcaggacatcttcgttccggacatcggttcgggt
ggcactgccaaggtcatcgaggtgctggtcaaggccggtgacaccgtcgaagccgagcag
tctctgatcaccctggaatccgacaaggccagcatggagatcccctcccccgccgccggc
gtggtggagagcgtagaagtcaagctggatgccgacgtcggcaccggcgacctgatcctc
aagctgcgcgtcgctggcgtcgctcccgctgctgcccagactccggtccaggccgctgcg
cctacggccgccccggcaccggctgctgctcctgcccccgcggctgccgcctcggtgcag
gacatcaaggttccggacatcggttcggccggcaaggccaaggtcatcgaagtcctggtc
aaggccggcgacaccgtcgaagccgaccagtcgctgatcaccctggaatccgacaaggcc
agcatggaaatcccctcgccggctgccggcgtagtggaaagcgtcgaggtcaagctggac
gccgaagtcggcaccggtgacctgatcctcaagctcaaggtcgcaggcgccgcacctgct
gcggaacaaccggtgcatcgcgtaccggaaggcgctcacccggtcgccgccgccgaggtc
accgccatcgcggccctggccgcagccgccgcgaacaccaccggcgtaccggcgcgctcc
agtggcgccaaggtccacgcaggcccggcagttcgccaactggcccgcgagtttggcgtc
gacctggccgtcgtgccggccaccggcccacatggccgcgtgctgaaggaagacgtgcag
acctacgtcaaggccatgatgcagaaggccaaggaagccccggccgcagctgctggcgca
accggcggagccggaatcccgccgatcccggcagtggacttcagcaagttcggtgaaatc
gaagaagtggcgatgacccgcctgatgcaggtcggcgccgccaacctgcatcgcagctgg
ctcaacgtcccacacgtgacccagttcgattcggccgacatcaccgaactggaagccttc
cgtgtggcccagaaggctgtggcggaaaaggccggcgtgaaactgaccgtgctgccgctg
ctgctcaaggcctgcgcctacctgctcaaggaactgccggacttcaacagctccctggcg
cccagtggcaaggcactgatccgcaagaagtacgtgcacatcggctttgccgtggacacc
ccggacggcctgctggtgccggtgatccgcgacgtagaccagaagagcctgctgcaactg
gctgccgaagccgctgccctggctgagaaagcccggaccaagaagctctcggcagacgac
atgcagggcgcctgcttcaccatctccagccttggccacattggcggcaccggcttcacg
ccgatcgtcaacgcgcctgaggtggcgatcctgggcgtgtccaaggccgcaatgcagccg
gtatgggatggcaaggccttccagcctcgcctgatgttgccgctgtcgctgtcgtacgac
caccgcgtgatcaacggcgccgccgccgcgcgcttcaccaagcgccttggcgacgtgctg
gcagatattcgcaccatgctgctgtaa

DBGET integrated database retrieval system