KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0001Help
Entry
Pse7367_0001      CDS       T02369                                 

Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pseu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pse7367_0001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pseu03032]
    Pse7367_0001
   03036 Chromosome and associated proteins [BR:pseu03036]
    Pse7367_0001
DNA replication proteins [BR:pseu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Pse7367_0001
Chromosome and associated proteins [BR:pseu03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Pse7367_0001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C IstB_IS21 DnaA_N AAA AFG1_ATPase ATPase_2 RNA_helicase AAA_19 AAA_16 TsaE
Motif
Other DBs
NCBI-ProteinID: AFY68322
UniProt: K9SCJ0
Position
61..1587
Genome map
AA seq 508 aa AA seqDB search
MDISKDTLWTMVLEYLEGEVSRPALESWIKTALPEELTPEKFVLRTPHSFARNWLFKYYY
HRLKEVVAEILGYTVEVQILTAQQLDSNAVEMPEDVYGHKDIILLSDDTPTEITAAGANN
LVRAGNSNSNGSDRQDSPSATNASNGSNSNGVRTGKINPKYTFSRFVVGATNRMAHAAAL
AVAESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLEISTDQKIFYVSTEQFTNDLISAIR
QDSMQAFREHYRDVDMILVDDIQFIEGKEYTQEEFFHTFNTLYESGKQIILASDRPPAQI
PRLQERLCSRFSMGLIADVQVPDLETRMAILQKKAEYENLRIPSEVIHYIAASYTSNIRE
LEGALVRAVTYISISGLPMTVDNVSPVLNAPKEPVEIAPAQVVDLVAAYFEVEAEAMRGS
SRKRTISLARQVAMFLMRQHTSLSLPKIGDELGGKDHTTVMYSCDKIAQQQEKDPEMAQA
LREISDRIYHIAKEGDAPAKSIEGGNRK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacatctccaaagacacactgtggacaatggtgctggaatacctcgaaggcgaggtg
agtcgccctgccctggaatcatggatcaaaactgcgctacccgaagaactaacgccggaa
aagtttgtgctgcgcacgccccattcttttgcccgcaactggctgtttaaatactattat
catcgcctcaaggaagtagttgccgagattttgggctatacagtggaggtgcaaattctt
actgcccaacaactcgactccaatgcggtggaaatgccggaggatgtctatggccacaaa
gatattattttgctctctgatgacacacccaccgagattacagcagctggtgccaataat
ttagtcagagccggaaatagcaattccaatggtagcgatcgccaggacagtccaagtgct
actaatgccagcaatggcagtaatagtaatggtgtgcgcacgggcaaaatcaaccccaaa
tatactttttcgcggtttgtggtgggggcaaccaatcgtatggctcatgcagcagcattg
gcggtggccgagtcgccggggcgggaatttaacccgctgtttttgtgtggtggggtgggg
ctggggaagacccatctaatgcaggcgatcgcccactatcggttagaaatttccaccgat
caaaagattttttatgtctcaaccgagcaattcaccaatgatttgatcagtgcgatccgc
caggacagtatgcaggcgttccgggagcattaccgcgatgtggatatgattctggtggat
gatattcaatttattgaaggcaaagaatatacccaggaagaatttttccatacttttaat
acgctctacgaaagcggtaagcagattattctggccagcgatcgccccccagcccagatt
ccccggctccaggagcgattgtgctcgcggttttcgatgggattgattgccgatgtgcag
gtgcccgatttagaaacccgcatggcgatcttgcaaaaaaaggccgaatatgaaaatctg
cgcattcccagcgaagtgattcactacattgccgctagctatacctctaatattcgagag
ctagaaggagccttagtacgggcggttacctatatttcaatttccggtttgcccatgacc
gtggataacgtttcgccagtcctgaatgcccccaaagaaccagtggagattgcgcctgct
caagtagtagacctggtggcggcatattttgaggtagaagctgaagccatgcgggggagt
tcgcgcaaacggactatttccctggcgcgtcaggtagcaatgtttttaatgcggcagcat
accagcctcagcttgcccaaaattggtgatgaattaggtggcaaagaccatacgacggtg
atgtatagctgcgataagatcgcccagcaacaggaaaaagatcccgaaatggcgcaagct
ctccgggaaattagcgatcgcatttatcacattgccaaggagggcgatgcaccggcaaaa
agcattgagggcggaaatcgtaagtag

DBGET integrated database retrieval system