KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0394Help
Entry
Pse7367_0394      CDS       T02369                                 

Definition
(GenBank) ferredoxin protochlorophyllide reductase subunit L
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00860  Porphyrin and chlorophyll metabolism
pseu01100  Metabolic pathways
pseu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pse7367_0394
Enzymes [BR:pseu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Pse7367_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ AAA_24 MeaB AAA_25
Motif
Other DBs
NCBI-ProteinID: AFY68705
UniProt: K9SEY2
Position
complement(500690..501550)
Genome map
AA seq 286 aa AA seqDB search
MKLAVYGKGGIGKSTTSCNISVALAMRGKKVLQIGCDPKHDSTFTLTGYLIPTIIDTLAE
KDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVIL
FDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKSRTHPLRLAGLIGN
RTSKRDLIDKYIEAVPMPVLEILPLIEDIRVSRVKGKTLFEMADHDPDLAWVCDYYLNIA
DQLLALPEGVVPKDAADRELFSLLSDFYLNPATAPKREEELDLMMV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactagcagtttatggaaaaggtggcattggcaaatcgaccaccagttgtaatatt
tccgtggctttggccatgcgcggcaagaaagtattacagatcggctgcgatcccaagcat
gacagtacctttacgctgaccggttatttaatccccacgatcatcgacaccctggccgaa
aaggactaccactacgaagatgtctggccagaggatgtgatctacaagggctatggtggc
gtggattgcgtcgaagcgggtggccccccagcaggtgctggttgtggtggctatgtggtt
ggcgaaaccgtgaagctactcaaggaactcaacgcctttgatgaatatgacgtgattctg
tttgatgtgttgggcgatgtggtttgcggtggatttgccgccccgctcaactatgccgac
tattgcatgatcgtcactgacaatggctttgatgcgctgtttgccgccaatcggatcgcg
gcttcggttcgtgagaaatcccgcacccacccactgcgcttagctggcctgattggcaat
cgcacctccaagcgcgatctaattgacaaatatattgaagcagtaccaatgccagtgttg
gaaatcctgcccctgatcgaagatattcgggtttcccgcgtcaagggcaaaaccctgttt
gagatggccgatcatgatcccgacttggcctgggtctgtgattactacctcaacattgcc
gatcaacttttggccttgcctgagggcgtagtacccaaggatgccgccgatcgtgaactg
tttagcctgctgtctgatttctacctcaatccagccactgcgccaaaacgcgaagaagag
ctagatctaatgatggtttag

DBGET integrated database retrieval system