KEGG   Pseudanabaena sp. PCC 7367: Pse7367_1791Help
Entry
Pse7367_1791      CDS       T02369                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pse7367_1791
Enzymes [BR:pseu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Pse7367_1791
Transporters [BR:pseu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Pse7367_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C_3 GST_N_2 GST_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AFY70068
UniProt: K9SIN2
Position
2256226..2256780
Genome map
AA seq 184 aa AA seqDB search
MLKLYGGARSRASIVQWYLEELAAPYEFVMLDMKAEQHLQPDYLAINPFGKVPGIVDGDF
KLFESGAILIYLAEKYNKIGDSLAQRATLAQWVLFANSTLGNGLFLEASREKEIPRLLPP
LNEILASQPFLMGAEFSAADVAVGSLLGYATFMIPLDFKDYPAIANYVKQLADRPAYRKS
ILKK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagctttatggtggggctcgcagccgtgcttcgatcgtgcagtggtatttagaa
gaactggccgccccttacgagtttgtgatgttggatatgaaggcagagcagcatttgcag
cccgattacctggcgatcaatcccttcggcaaagtgcctggcattgtcgatggtgatttt
aagctatttgagtcgggtgctattttgatctacctggccgagaaatataacaaaattggc
gattctctggcacaaagagccactctggcacagtgggtactttttgccaactccaccctg
ggtaatggtttgtttcttgaagccagccgtgagaaagaaattcctcgcctgttgccacct
ttgaatgagattttggcgagccagcctttcctgatgggtgcagaattcagcgctgcagat
gtggcggtgggctctttgctgggttatgccacattcatgatcccactggatttcaaagac
tatccggcgatcgctaattatgtgaaacaactggccgatcgccctgcctatcgtaagtcg
atcctcaaaaagtag

DBGET integrated database retrieval system