KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2358Help
Entry
Pse7367_2358      CDS       T02369                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00010  Glycolysis / Gluconeogenesis
pseu00520  Amino sugar and nucleotide sugar metabolism
pseu01100  Metabolic pathways
pseu01110  Biosynthesis of secondary metabolites
pseu01120  Microbial metabolism in diverse environments
pseu01130  Biosynthesis of antibiotics
pseu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pse7367_2358
   00520 Amino sugar and nucleotide sugar metabolism
    Pse7367_2358
Enzymes [BR:pseu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Pse7367_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFY70619
UniProt: K9SLD8
Position
2975755..2976468
Genome map
AA seq 237 aa AA seqDB search
MTEEKLTLAIDVGGSGIKAMVLLPDGTPKTERVRLETPQPSTTDAVVATIIKLAEMQGEF
DRVSVGFPSVVRNGVTQKANNLGDTWHDFDLAKVLQTEFKRPVRVANDADIQGLGAIAGT
GTELVITLGTGFGSALFIDGRLVPNLELCNHYFMHGKNKEKSYEDALGDQALEKIGKKDW
NKRLAKAIDSLEALFNYDYLYIGGGNSKHIKFELPSNVKIIPNITGILGGIALWRDV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaaaaattgaccctggcgattgatgtgggcggcagtggcattaaagcaatg
gtcttgttgccggatggtacgcccaaaaccgaaagagtgcgcctggaaacgccgcaacca
tctacaaccgatgcggtggtggctacgatcattaagctggcggaaatgcagggcgagttc
gatcgtgtttcggttggttttcccagcgtggtgcgcaatggcgtgacccagaaggcaaat
aatctgggtgatacctggcatgattttgacctggccaaggtgttgcaaactgaatttaaa
cgcccagtgcgggtagccaatgatgcggatattcaaggcttgggggcgatcgctggcact
ggtacggagttagtgattacgctggggactgggtttggctctgctctgttcattgatggc
aggctggtgccgaatttggagctttgcaatcattactttatgcatggcaaaaacaaggaa
aaaagctatgaagatgcattgggcgatcaggcgttagaaaagattggcaagaaagactgg
aataagcgtttagccaaggcgatcgattccctggaagctctgtttaattatgattatctt
tacattggcggtggtaatagcaagcatattaaatttgagctgcccagtaatgtaaaaatc
atccccaacatcactggtatcctgggtgggattgcgctctggcgagatgtttaa

DBGET integrated database retrieval system