KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2576Help
Entry
Pse7367_2576      CDS       T02369                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00790  Folate biosynthesis
pseu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pse7367_2576
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pseu04147]
    Pse7367_2576
Enzymes [BR:pseu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Pse7367_2576
Exosome [BR:pseu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pse7367_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AFY70834
UniProt: K9SM26
Position
complement(3234590..3234871)
Genome map
AA seq 93 aa AA seqDB search
MAVEKLSPQAINDGLSTLTGWEIKNEKLNKSFKFKDFNEAFGFMTRIALVAESINHHPEL
FNVYNNVTIDLTTHDAGGISNLDLEFAKRVNSF
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagaaaaattatcccctcaggccattaatgatggtttgtcaaccttgacagga
tgggaaatcaagaacgagaagcttaataagtcatttaagtttaaggattttaatgaggcc
tttggctttatgacccgtattgctttggtggctgagagcattaatcatcatcctgagctg
tttaatgtttacaacaatgtcacgatcgacctgaccacccatgatgctggcggcattagt
aacttagatcttgaatttgccaagcgagtaaattcattttga

DBGET integrated database retrieval system