KEGG   Pseudovibrio sp. FO-BEG1: PSE_0030Help
Entry
PSE_0030          CDS       T01669                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00010  Glycolysis / Gluconeogenesis
psf00020  Citrate cycle (TCA cycle)
psf00620  Pyruvate metabolism
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
psf01200  Carbon metabolism
Module
psf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_0030
   00020 Citrate cycle (TCA cycle)
    PSE_0030
   00620 Pyruvate metabolism
    PSE_0030
Enzymes [BR:psf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSE_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 DUF915 PGAP1 DUF676 Abhydrolase_5 Lipase_3 Lipase_2 DUF900 Thioesterase Abhydrolase_3 Esterase Ser_hydrolase Esterase_phd UPF0227 DUF2974 BAAT_C Ndr LIDHydrolase DUF2048 DLH CAMSAP_CC1 Sugar-bind AXE1
Motif
Other DBs
NCBI-ProteinID: AEV34542
UniProt: G8PFK4
Position
31346..32128
Genome map
AA seq 260 aa AA seqDB search
MNIDSIQDVTCLPFTAFGPESAEPIIFIHGFGGDASTWRNIQVQLENKRRTIAFDLPAHG
RALADFEPCNAVGSAKAVVKSLDALKLDRVHLVGHSMGGAIAALIAMRSPERIASLTLLA
PGGFGPEINAKLLRRYAVGQTEAEQQVLLEQFVGLEFELPRKLADYVATQRSTPGAAEAL
KAVSGLILEGESQGVLPTDKLGELPMPIKVVWGTQDKILPTRQCHKLPGPIACHVFDRVG
HMVHMEIPQEVIRLILENTR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgatagtatccaagatgtaacctgcctgcctttcacggcctttggtcctgaa
agcgcagaaccaattattttcatccatggctttggcggtgacgccagcacatggcgcaat
attcaagtccaattagaaaacaaacgccgcacgatagccttcgatctgccggcccacggt
cgcgcacttgcagactttgaaccgtgtaacgctgttggctctgccaaagctgtcgtgaag
tctcttgatgcattgaagctcgatcgtgtccatttggttggccatagcatgggcggcgca
atcgcagcgctgattgctatgcgcagtccagaacgcatcgcaagcctcaccctattggcc
ccaggtggtttcggtccggaaatcaacgccaaacttctacgccgctacgcagtcgggcaa
accgaagcagaacaacaggtgttgctggagcagttcgttggtcttgagttcgagcttcct
agaaaactggccgattacgttgccacccaacgttcaactccaggcgcagctgaagcactg
aaagcggtttccgggcttattctggaaggtgaaagccaaggcgtactgccaacagacaag
ctgggcgagctaccgatgccaatcaaagtggtgtggggcacacaggacaagatcctgcca
acacgccaatgccacaaactgccaggcccaatcgcctgccacgtcttcgatcgtgttggt
cacatggtccatatggagatccctcaggaagtaatccggcttattctggaaaacacgcgc
taa

DBGET integrated database retrieval system