KEGG   Pseudovibrio sp. FO-BEG1: PSE_0174Help
Entry
PSE_0174          CDS       T01669                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00071  Fatty acid degradation
psf00072  Synthesis and degradation of ketone bodies
psf00280  Valine, leucine and isoleucine degradation
psf00310  Lysine degradation
psf00362  Benzoate degradation
psf00380  Tryptophan metabolism
psf00620  Pyruvate metabolism
psf00630  Glyoxylate and dicarboxylate metabolism
psf00640  Propanoate metabolism
psf00650  Butanoate metabolism
psf00900  Terpenoid backbone biosynthesis
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
psf01200  Carbon metabolism
psf01212  Fatty acid metabolism
psf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSE_0174 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    PSE_0174 (phbA)
   00640 Propanoate metabolism
    PSE_0174 (phbA)
   00650 Butanoate metabolism
    PSE_0174 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSE_0174 (phbA)
   00072 Synthesis and degradation of ketone bodies
    PSE_0174 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSE_0174 (phbA)
   00310 Lysine degradation
    PSE_0174 (phbA)
   00380 Tryptophan metabolism
    PSE_0174 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSE_0174 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSE_0174 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSE_0174 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psf04147]
    PSE_0174 (phbA)
Enzymes [BR:psf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSE_0174 (phbA)
Exosome [BR:psf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSE_0174 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEV34686
UniProt: G8PHK4
Position
172410..173594
Genome map
AA seq 394 aa AA seqDB search
MTSPNDVVIVSATRTPIGSFNGSFANTPAQDLGTAVIKSALDQAKVEANDVNEVIFGHVL
TSGLGQNPARQAALNAGMADDSTAIVINQVCGSGLRAVAMGMQQIQSGDADIIVAGGQEN
MTLSPHCQSLRAGVKMGDYSMTDTMLKDGLIDAFQGYHMGITAENIAEKYQITREAQDEF
AVSSQNKAEAALKAGKFKDEITPITVKERRAERVVEDDEYIRVGANIESMQKLRPAFKKE
GTVTAANASGINDGAAALVLMSAEAAEKRGLTPLATIKSWATAGVDPAYMGLGPIPASKK
ALEKAGWSIEDLDLVEANEAFAAQALAVGQELGIDSDKLNVNGGAIALGHPIGASGARVL
VTLLHEMKREEKKKGLATLCIGGGMGIALCVERK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcctaatgatgttgtaattgtaagcgcaacacgtaccccaatcgggtccttc
aacggttccttcgccaacacccctgctcaggatcttggcaccgcagttatcaagtcagct
cttgatcaggcaaaagtggaagcaaacgacgtcaacgaagtgatcttcggtcatgtgctc
acgtctggtcttggtcagaacccggctcgtcaggcagcactcaacgctggcatggcagat
gattcgactgcaatcgttatcaaccaggtttgtggctcaggcctgcgcgcagttgccatg
ggcatgcagcagatccagtccggcgatgcagacatcatcgttgcaggtggtcaggaaaac
atgaccctgtccccacactgccagagcctgcgggcgggtgtgaaaatgggcgactattcc
atgaccgacaccatgctcaaagacggcctgatcgacgcgttccaaggctatcacatgggt
atcactgcagaaaacatcgcagaaaagtaccagatcacccgcgaagcacaggacgagttc
gctgtttcatctcagaacaaagcagaagctgcgctgaaggctggcaagttcaaagacgaa
atcactccaatcaccgtgaaagagcgcagagctgagcgtgtggtggaagatgatgaatat
atccgcgtaggcgccaacattgaatccatgcagaaactgcgtccggcattcaaaaaggaa
ggtaccgtaacagcagcaaacgcatccggcatcaacgatggtgcagcagctctggttctg
atgagcgcagaagcagctgaaaagcgtggcctcaccccgctggcaaccatcaagtcctgg
gcaaccgctggtgttgatcctgcatacatgggtctcggcccaatcccagcttccaagaag
gcactcgaaaaagctggctggtccattgaagacctggatctggtggaagcaaacgaagca
ttcgctgcacaggcactggcagttggtcaggagctgggaatcgactcagacaagctcaac
gtcaacggcggcgcaatagctctgggtcatcctatcggagcatccggcgcacgtgtactt
gttactctgctacacgaaatgaagcgtgaagagaagaaaaagggccttgcaactctttgc
attggtggtggcatgggtatcgcactgtgtgttgagagaaaataa

DBGET integrated database retrieval system