KEGG   Pseudovibrio sp. FO-BEG1: PSE_0406Help
Entry
PSE_0406          CDS       T01669                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00071  Fatty acid degradation
psf00280  Valine, leucine and isoleucine degradation
psf00281  Geraniol degradation
psf00310  Lysine degradation
psf00360  Phenylalanine metabolism
psf00362  Benzoate degradation
psf00380  Tryptophan metabolism
psf00410  beta-Alanine metabolism
psf00627  Aminobenzoate degradation
psf00640  Propanoate metabolism
psf00650  Butanoate metabolism
psf00903  Limonene and pinene degradation
psf00930  Caprolactam degradation
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
psf01212  Fatty acid metabolism
Module
psf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSE_0406
   00650 Butanoate metabolism
    PSE_0406
  Lipid metabolism
   00071 Fatty acid degradation
    PSE_0406
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSE_0406
   00310 Lysine degradation
    PSE_0406
   00360 Phenylalanine metabolism
    PSE_0406
   00380 Tryptophan metabolism
    PSE_0406
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSE_0406
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSE_0406
   00281 Geraniol degradation
    PSE_0406
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSE_0406
   00627 Aminobenzoate degradation
    PSE_0406
   00930 Caprolactam degradation
    PSE_0406
Enzymes [BR:psf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSE_0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEV34918
UniProt: G8PK98
Position
410349..411122
Genome map
AA seq 257 aa AA seqDB search
MSYENILVETRGKVGLITLNRPKVLNALNSDLIAELDEALNVFDRDPEIGATVITGSEKA
FAAGADIKVMAEYDYPQTYLMDFITSWDQIAQKRKPIIAAVAGFALGGGCELAMMCDFIL
AAESAQFGQPEIKLGVMPGAGGTQRLTRLVGKSKAMEMCLTGRMMDAAEAERSGLVSRVV
ANDDLVEEALKAAEKIASFSTPIVMMTKESVNRSYEVTLAEGIRFERRLFHSMFATSDQK
EGMKAFIEKRKPEFEDG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgagaatattctggttgagacacgcggcaaggttggcctgattacgctaaac
cgcccgaaagtattgaatgcgctgaacagcgatctgatcgctgagcttgatgaagcgctg
aacgtgtttgatcgcgatcctgaaattggcgcgaccgtcatcaccggctccgaaaaagca
tttgctgcgggcgctgacattaaagtgatggctgagtacgactatccgcagacctatctg
atggacttcatcaccagctgggaccagatcgcgcagaagcgtaagccgatcatcgcagct
gttgcaggcttcgcgctgggcggtggctgtgagcttgctatgatgtgtgatttcattctg
gcagcggaatctgctcagtttggccagccagagatcaaacttggcgttatgccaggtgca
ggtggtacacagagattaacaaggcttgttggcaagtccaaagcaatggaaatgtgcttg
acaggccgtatgatggatgcagctgaagctgagcggtccggccttgtctctcgcgttgtt
gcaaatgacgatctggtcgaagaagcactcaaagctgctgaaaagattgcaagtttctcg
actccaattgttatgatgacgaaggaaagtgtaaaccgttcttacgaagtaacccttgca
gaaggtattcgttttgagcgtcgcttgttccattctatgtttgcaaccagcgatcaaaaa
gaaggtatgaaggccttcatcgaaaagagaaaacctgaattcgaagacggataa

DBGET integrated database retrieval system