KEGG   Pseudovibrio sp. FO-BEG1: PSE_1051Help
Entry
PSE_1051          CDS       T01669                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00010  Glycolysis / Gluconeogenesis
psf00052  Galactose metabolism
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_1051
   00052 Galactose metabolism
    PSE_1051
Enzymes [BR:psf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PSE_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim BAT Chlorophyllase2
Motif
Other DBs
NCBI-ProteinID: AEV35563
UniProt: G8PSD7
Position
1102866..1103858
Genome map
AA seq 330 aa AA seqDB search
MAIRDFGELENRETVKEVTLHGGDLTASILTYGATVRRLQLGDRDLTLGFDNLRDYELHS
PHMGATAGRCANRIANGCFSIGNDEFQLSVNEGGRHHLHGGHTGFAHRIWTIEEASEDSV
LLSLESPDGEEGYPGTVQITCRYTLTKDNTLRIEFSGSTDKPTLLNPAHHSYFNLGDHED
VTKHQIMIPARSYLPVSDELIPTGEILDVAGTAYDFREMRQVQDEQDNRFDNNFCLRQFR
LEKPELSAVVFEPETQIKMEVWSTEPGIQFYDGSSLNTPVPGFNGKMYGPRAGLCLEPQC
WPDSPNHEEFACSTLQPTEHYLQITEYRFI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtggctattcgtgatttcggtgagctggaaaaccgggaaactgtgaaggaagtgacactg
cacggcggagatctgaccgcaagcatcctcacttacggagccacagtacgcagactgcag
ctgggagaccgcgacctaacgctcggcttcgacaatctgcgcgactacgaacttcactct
ccacacatgggcgccaccgcaggccgctgcgccaaccgcattgcaaacggctgcttctca
atcggcaatgacgagttccaactctccgtcaatgaaggcggacgtcaccatctccacggc
gggcatacagggtttgcgcaccgcatctggaccatcgaagaagccagcgaagacagcgtt
ctgctctctttggaatctccggatggggaagaaggctatccgggcactgtccagatcaca
tgccgctataccctcaccaaagacaacacgctgcgcatcgagttttccggctccacagac
aagccgaccctgttgaaccctgcgcaccacagctatttcaatctgggtgatcatgaagac
gtgacaaaacaccagatcatgatcccggcccgctcttatctgccagtttccgatgagctg
atcccaaccggcgaaatcctcgatgtggctggcaccgcttacgatttccgcgaaatgcgc
caggtgcaggatgagcaggacaaccgttttgacaacaacttctgccttcgccagttccgt
ctggaaaagccagagctgtccgctgtcgtgtttgagcctgaaactcaaattaagatggaa
gtctggtcaaccgagccgggcattcagttttacgatggcagctcgctgaacacacctgtt
ccgggctttaacggcaaaatgtatggcccacgtgctggcttgtgccttgagccccaatgc
tggcctgatagcccaaaccacgaggagtttgcgtgttccacgcttcaaccaactgagcac
tacctgcaaataacagaataccgtttcatctga

DBGET integrated database retrieval system