KEGG   Pseudovibrio sp. FO-BEG1: PSE_1855
Entry
PSE_1855          CDS       T01669                                 

Gene name
icmF
Definition
(GenBank) Type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSE_1855 (icmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psf02044]
    PSE_1855 (icmF)
Secretion system [BR:psf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSE_1855 (icmF)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: AEV36365
UniProt: G8PFZ7
Position
complement(1956757..1960158)
AA seq 1133 aa
MAILSVIWGVSNLVYVSIKKKKVDLSKNKDKKEKPKTPDLSYLNEFERGFTQALQTISRN
WAGKGERKKGKNLYALPWFVVLGSPSSGKTSLIVESNLKFPLAHLFSQEDAKHVQPTKDV
DCWVTDEAVLFDVAGQFVEHVNGQQPDSKETYYSGLWRRFLKLLRDNRPRRPINGVVLCL
DLSELLSLSSQERTTKAALVHARLSEMTEVLGTRYTVHVVLTKFDLIDGFHEFIGCLAAA
ERAKPFGFTFDLHDGRDQDKWLDEFNSAFAKFLDDLNNTVVDRLSEMRSAHQRRQLYLFT
REMAGLSNILSSFLGKALHQDKFSTAPHIRGVFFSSARQEAIPTNPVLLATSQKYEIAAP
ILPIHSGPSKQYFSASLFDQVVFKEAGLAGDNIKIERAKRFALVGSGLAASLLYVGFFST
YWVGYENNRARADEVVDITESFEELFQQGPDKNLNASGQNYIRPLGALTSASDIFGNYRD
RNWLISQLSLYQGYKIGPEVEKAYVDMLARYFLPEVAAYVRNEIAALGNDETSKDSNERL
EALRVYLMLGDASRRNELLVKSWMEQKWQEQFEGDLKLQKALLDHLVFAIETAGLEAKLD
KDLVETSQRDLREVPRDLRLYRNIEQVSDRQLASPVNFRNDIGPAYNIVFSGTGTTAHDD
QPIGVKQFFTKDAYLDYFVKMNDGLSVVAVEDAWVADERDTVEYSQADLKEFRRKIASRY
ATNYISNWNDALNRLEITDFRNLDHAVDILETLTGPDRPLNRLINRVKSETEIYESKLIE
LNAEQAVNSDLPFDIYREQGLRVRRAFSNLNGLVEAEEGEKAYLEDLDAALNTLYEYLKD
IRQAGERSGEVALARAKARIDLQGEDPIYTLKRIGVDLPSPLNRFFAKLADQSWKVLLQE
AKKELQRSWNEEIYADYNLNYAQLYPFNKQAEQEIPLEEFESFFGPGGKIETFYKKNLIV
FVDEATGEPKTIDGRHLAIAKEFQDNLKIILDLRRSYFNSEGLIGVEYNIQPISLSAKLR
RAVMNIEGQIISYSHGPRRPIRVIWPNVLTNEAESSLSVFPAGRGRPHTTTFKGPWSGFR
LLDFATTKGFDSNGALIEFSFNGQKATYSLLHKGASSLARKQPLSGLILPAKM
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggccatactttctgtcatttggggcgtgagtaacttagtttatgtaagcataaagaag
aaaaaggttgatttaagtaaaaataaagacaaaaaagaaaagccaaagacacctgatcta
tcctatctgaatgagtttgaacgcggcttcacacaggcactccaaacaatcagcagaaat
tgggcaggcaagggtgaacggaagaaaggaaagaacctctacgcacttccctggttcgtc
gtattgggctctcccagttcaggtaagacatccctgatcgttgaatcgaatttaaagttc
ccgctcgcccacctattctctcaggaagatgcaaaacacgtccaaccaaccaaggacgtc
gattgctgggtaactgatgaagctgttctctttgatgtcgcaggccagttcgttgagcat
gtaaacggccagcaaccagactctaaagaaacgtattactccggtttatggcgtcgtttc
ctaaagcttttgcgggataaccggccacgcagaccgatcaatggcgtcgtattgtgtctg
gatctctcagaactgctttcactcagctcgcaagaacgaacaacgaaagcagcccttgtt
cacgctcgcctgagcgaaatgacggaagtgctcggcactcgctacaccgtacatgtcgtg
ctgacaaagttcgatctgatcgatggtttccatgagttcattggatgtctggctgcagcc
gaaagagcaaaaccgttcggctttacatttgatcttcacgatggccgtgatcaagataag
tggttggacgagttcaattcagcctttgccaagtttcttgatgacctcaacaacaccgtt
gtcgaccgactttctgaaatgcggtcggcgcatcaaaggcgccagctatacttgttcacg
cgcgaaatggctggtctgagcaatatactgagctcttttctggggaaagccctccatcag
gacaagttttcaactgctcctcatatccgcggtgtcttcttttcctctgcacgtcaggag
gccattcccacaaatccggttttactggcaacttcgcagaagtatgagatcgcagcacct
atcctgcccattcatagcggtccatccaaacagtacttctctgcttcactctttgatcag
gtcgtgttcaaggaagccggccttgcgggcgataacatcaagatcgagcgcgccaaacgc
ttcgctctcgtcggatcaggccttgccgcttctcttctttatgttggctttttcagcacc
tattgggtcggctatgaaaacaatcgggcacgagctgacgaggtcgtcgatataaccgag
agcttcgaagagctgtttcagcaaggtcctgataagaatcttaacgcctctggacagaac
tacatccgtcctcttggcgcactcacatctgcaagcgacatctttggcaactatcgcgac
agaaactggcttatctcccaactctcactttatcagggctataagatcggcccggaagtt
gaaaaagcctacgtcgatatgctggcccgctacttcctcccagaggttgcagcatatgtc
cgaaacgagatcgcagctcttgggaatgatgaaaccagcaaagacagtaatgaacgtctg
gaagcgttgcgtgtctaccttatgctgggcgacgcttcccggcgaaatgagctcctcgta
aaatcctggatggaacagaaatggcaggagcagtttgaaggcgatctcaaactacaaaaa
gcgctgctcgatcatcttgtctttgccatcgaaaccgccgggctagaagcgaagctggac
aaagatctggttgagacctctcaaagagatctgagagaagtgccacgagatctgcgcctc
taccgcaacatcgagcaagtcagtgacagacagctggcctctccggtgaacttcagaaac
gacatcgggccggcatacaacatcgttttcagcggaaccggcaccaccgctcatgatgat
caaccaattggggtaaagcagtttttcacaaaagatgcttatctcgactatttcgtcaaa
atgaatgatggcctgtccgtcgtcgccgtagaggatgcctgggtggccgacgagcgggac
accgtggaatattcccaagctgacctaaaagagttccgtcgcaaaatcgcatcccgctat
gcaacgaactacatctccaactggaatgacgcgctgaaccgtttggaaattacggacttc
agaaatctagaccacgccgtagatattctggaaacactaactggcccagacaggcctctt
aatcggctcatcaaccgggttaagagtgaaacagaaatctacgagagtaagctcattgag
ctcaatgccgagcaagccgtcaattctgatttgccctttgacatctatagagaacaaggc
ctccgcgttcgccgcgccttttccaacctcaatggattggtggaagctgaagaaggtgag
aaggcttatctggaagatctagatgcggcccttaatactctttacgaatatctgaaagac
atccgccaagccggggaacgatctggcgaagttgcattggcacgtgccaaagccagaatt
gatcttcagggcgaagacccaatctatacactcaaacgcataggcgtcgaccttcccagc
ccactcaatcgctttttcgcaaaactggcagatcaaagttggaaggtgttgctgcaagaa
gccaagaaagagctgcaacgcagttggaacgaggaaatctatgcggactataaccttaac
tacgcacagctttatcctttcaacaagcaggctgagcaagagatcccacttgaagaattt
gaaagcttcttcggcccgggcggcaagatcgaaacgttctacaaaaagaacctgatcgtg
tttgttgatgaggcaacgggcgagcctaaaaccatcgatggtcgccatctcgccatcgct
aaggaatttcaggataatctcaagatcatcttagatctgcgcagaagctacttcaactca
gaaggactgatcggtgtggagtacaacatccagcctatctctctttccgcaaaactccgc
cgcgccgtgatgaatattgagggacaaatcatttcctactcccatggtccacgtcgccct
atccgagtgatctggccgaatgttctcacaaatgaagctgagagcagcctatcagtcttc
cctgcgggtcgtggtcgcccacacaccaccacctttaaggggccgtggtcaggcttccga
ctgctggattttgccacgactaaaggctttgatagcaatggcgcactgatcgagttcagc
ttcaacgggcagaaagcaacatactccttgcttcataaaggagccagttcactggcacgc
aaacagccactctccggccttatcctgccagcaaagatgtga

DBGET integrated database retrieval system