KEGG   Pseudovibrio sp. FO-BEG1: PSE_1856
Entry
PSE_1856          CDS       T01669                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
KEGG Orthology (KO) [BR:psf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psf02044]
    PSE_1856
Secretion system [BR:psf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSE_1856
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEV36366
UniProt: G8PFZ8
Position
1960615..1961124
AA seq 169 aa
MAGKEGSVAPKERINIRYVPATGDQQEEVELPLRLVMLGDYNGKEDDTPLEDRELLSVDK
NTFASVMKEAGLERELTVKNTLVEDEDAQLAVNLKFEGLKDFEPDSIVKQVPELKKLIDL
REALVALKGPLGNIPAFRNRLEQILQDKEQREKLLSELDAVVSSQEETS
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctggcaaggaaggttctgttgcgccaaaagagcgaattaatattcgttatgttccg
gcaactggtgatcagcaggaagaagttgaactgccgctgcgtctagtcatgctgggtgat
tacaacggcaaagaagatgacacgcctcttgaagaccgcgagctgctttccgtcgataaa
aatacctttgcatcggttatgaaagaagctggtctggagcgtgagctgacagttaaaaat
acccttgttgaagatgaggatgcgcagctggccgtcaacttgaagtttgaaggcctgaag
gactttgagccagactccattgttaaacaagtgcctgaacttaaaaagctaattgatctt
cgtgaagcgctggttgctttgaaagggccgcttggaaacataccggcattccgtaaccgg
ctcgagcagattttgcaggacaaagagcaaagggaaaagcttttgtcagagctggatgca
gtcgtgtcttctcaggaagaaaccagctga

DBGET integrated database retrieval system