KEGG   Pseudovibrio sp. FO-BEG1: PSE_1857
Entry
PSE_1857          CDS       T01669                                 

Gene name
evpB
Definition
(GenBank) type VI secretion protein EvpB
  KO
K11900  type VI secretion system protein ImpC
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
KEGG Orthology (KO) [BR:psf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psf02044]
    PSE_1857 (evpB)
Secretion system [BR:psf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSE_1857 (evpB)
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AEV36367
UniProt: G8PFZ9
Position
1961221..1962714
AA seq 497 aa
MVDVSASAGQPDVAGAGAAISLLDQIMEETRIRPEDEESYSIARRGVEAFISDLLSSQEV
DQRINRVLVDRMISELDLKVSSQLDEILHDEKFQELESAWRGLKLLVDRTDFRENIKIDV
LSVSKDKLLEDFETSPEVVQSGLYKHVYSSGYGQFGGEPVGAMIANYDFGPGARDVKLLQ
FAASVGAMAHAPFIAAAGPKMFDVDEYVDLPAQKDLFSIYEGPRFRKWMGFRQSEDSRYV
GLTCPRFLLRMPYDAEENPVDAFVYNENVTEEHESYLWGNTSFLMATRLTESFAKYRWCP
NIIGPQSGGAVHDLPVHVFEAFGQLEEKIPTEVLVTDRREFELAEEGFIALTMRKGSDNA
AFFSANSAQKPKIFQNTKEGKEAETNYKLGTQLPYMMIVNRLAHYIKVLQREQIGSWKER
EDLERELNTWLRQYVADQENPPQDVRSRRPLRAAEVIVSDVEGDPGWYQVSLKVRPHFKY
MGANFELSLVGKLDKDS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtagatgtatcagcctctgccggccagccggatgttgccggtgcgggcgccgcgatt
tctcttttagatcagattatggaagaaacgcgcattcgcccggaagacgaagaaagctat
tccatagcgcgcagaggcgtagaggcgtttatttccgacctcctttccagtcaggaagtt
gatcaacggatcaatcgcgttctggtcgatcgcatgatctccgagttggacttgaaagtt
tcctcgcagctggacgaaatccttcatgatgagaagtttcaggaacttgagtctgcctgg
cgcggactgaagctgctggttgatcgcacagatttccgtgaaaacatcaagatcgatgtg
ctttctgtttccaaagacaagctgctggaagattttgaaacgagcccggaagtcgtacaa
tccggcctttacaagcacgtctattcaagtggttatggccagtttggtggtgagccagtc
ggcgccatgattgcgaactatgactttggtccaggtgctcgtgatgtaaaactgctgcag
tttgctgcttctgtcggtgcaatggcacacgctccatttattgcggcggcaggtccaaag
atgttcgacgttgatgagtatgtggatctgccagcgcagaaagatctgttttccatctac
gaaggaccgcgtttccgcaaatggatgggcttccgacagagtgaagactcccgctatgtt
ggcttgacatgtccacgcttcttgcttcgcatgccgtatgacgctgaagaaaatccagtt
gatgcgttcgtctacaatgagaacgtgacggaagagcatgagagctacctttggggtaat
acttccttcttgatggcgacccgccttacagagagctttgcgaaataccgttggtgtcca
aacatcattggccctcaatctggtggtgctgttcacgatcttccagtgcatgtgttcgaa
gcatttggtcagcttgaagagaaaatcccgacagaagttctggtcacagatcgtcgcgag
tttgagcttgcagaagaaggcttcattgcgctgaccatgcgcaaaggctctgacaatgcc
gctttcttctccgcaaactctgcccagaagccgaaaatcttccagaatacgaaggaaggt
aaagaagcggagaccaactacaaacttggtacgcagcttccttacatgatgattgtgaac
cgtctggcgcactacatcaaagtgctgcagcgtgagcagattgggtcctggaaagaacgt
gaagatcttgagcgtgagctgaacacctggctgcgccagtacgtggccgatcaggagaac
ccacctcaagatgtgcgttcacgtcgtccattgcgtgctgctgaagttatcgtctccgat
gttgaaggtgatccgggttggtaccaggtgtctttgaaggtgcgtccgcacttcaagtac
atgggtgcaaactttgagctgtcgctcgtaggtaagctggacaaggatagctaa

DBGET integrated database retrieval system