KEGG   Pseudovibrio sp. FO-BEG1: PSE_1858
Entry
PSE_1858          CDS       T01669                                 

Definition
(GenBank) Type VI secretion system, lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
KEGG Orthology (KO) [BR:psf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psf02044]
    PSE_1858
Secretion system [BR:psf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSE_1858
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AEV36368
UniProt: G8PG00
Position
1962784..1963182
AA seq 132 aa
MFERLIADEEEVAPPQSVDLLEAKVNSIKRHLAKLLNARAGASAATPDLGLVDFNLSSVA
TNDLTQHIAASIRQCIERYEPRVKVRSVHFVRDPDRPLELRFKATLLMPALSKGEQVQID
ILMKDGHVAHIV
NT seq 399 nt   +upstreamnt  +downstreamnt
ttgtttgagcgtttgattgctgatgaggaggaggtagctcctcctcagagcgtcgatttg
ctggaagccaaagtaaattcgatcaaacgtcacttggctaaactgttgaacgccagagca
ggggcttctgctgctactccggatttagggctggtggacttcaacctgtccagtgttgcg
accaacgatctgacccaacacatcgcagcgtctattcgccaatgcatcgagagatacgaa
ccgcgggtgaaggtgcgatcagttcattttgtccgtgatcccgacaggccgttagagctg
cgcttcaaagcaacgttgctcatgcccgcccttagcaagggagagcaggtgcaaatcgat
atcctcatgaaagacgggcatgtcgcccacattgtttag

DBGET integrated database retrieval system